KEGG   Rhodococcus sp. p52: IM25_11940
Entry
IM25_11940        CDS       T05434                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00040  Pentose and glucuronate interconversions
rhq00051  Fructose and mannose metabolism
rhq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IM25_11940
   00051 Fructose and mannose metabolism
    IM25_11940
Enzymes [BR:rhq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     IM25_11940
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 Pyr_redox AdoHcyase_NAD Methyltransf_16
Other DBs
NCBI-ProteinID: AOD22231
UniProt: A0A1B2UDJ2
LinkDB
Position
2571163..2572182
AA seq 339 aa
MRAAVLLEPGRIEMQERPLPAPEPGDVLVRVTTVGVCGSDAHYYREGRIGEFVVTDPIVL
GHEASGVVVAVGDGVPQSRIGERVSIEPQRPDPLTEETRRGDYNLCPHMRFYATPPVDGA
LCEYVTIGAAFAHPVPDTVSDDAAALCEPLSVGIAAVRKARVTAGSRVLVTGAGPVGIVV
AQVARAFGAVEVVVTDLDERRRETALSFGASAALDPRVDDPSALRVDAYVDASGAPSAVD
SGIRAVRPGGTVVLVGSGAETMTLPVQWVQNRELILTGVFRYANTWPTALALLGAGRVDL
DSMVTARFPLDKTADALESDRTPGNIKAVVDVTDPAGKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgcgtgccgccgtacttctcgaaccgggccgcatcgagatgcaggaaaggccactacct
gcaccggagcccggcgacgtcctcgtccgggtgaccaccgtaggggtgtgcggttcggac
gcgcactactaccgcgaaggacgtatcggcgagttcgtcgtgaccgatccgatcgtgctc
ggccacgaggcgtccggggtcgtggtcgcggtcggggacggtgttccgcagagccggatc
ggcgagcgggtctcgatcgaaccgcaacgccccgacccgctcaccgaggagacgcgccgc
ggcgactacaacctgtgcccgcacatgcgcttctacgccacaccgcccgtcgacggcgcg
ctgtgcgagtacgtcaccatcggggcggccttcgcgcatcccgttccggacaccgtgtcc
gacgatgccgccgccctgtgcgagccgctgtcggtcggtatcgcggccgtccggaaggcc
cgtgtcaccgccggctcacgagtcctcgtcaccggtgccgggcccgtcggcatcgtcgtc
gcacaggtcgcgcgcgccttcggtgcggtcgaggtcgtcgtcaccgacctcgacgagcga
cgacgcgagaccgcactgtcgttcggggcgagcgctgcgctcgatccccgcgtcgacgac
ccgtcggccctgcgtgtggacgcctacgtcgacgcgtccggcgccccctccgccgtcgat
tcgggcatccgcgcggtccgtcccggcggcaccgtcgtcctcgtcggatccggcgccgag
acgatgaccctgccggtgcagtgggtccagaaccgcgaactgatcctgaccggcgtgttc
cgctacgcgaacacgtggccgaccgcgctcgcgctcctcggggcgggacgggtcgatctc
gactcgatggtcaccgcccggttccccctcgacaagaccgccgacgcactcgaatccgat
cggacacccggaaacatcaaggccgtcgtggacgtgaccgatccggcgggaaaggactga

DBGET integrated database retrieval system