KEGG   Rhodococcus sp. p52: IM25_12975Help
Entry
IM25_12975        CDS       T05434                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00640  Propanoate metabolism
rhq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    IM25_12975
Enzymes [BR:rhq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     IM25_12975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AOD24370
UniProt: A0A1B2UJP1
LinkDB All DBs
Position
2797832..2798878
Genome map
AA seq 348 aa AA seqDB search
MKALVFHGPGKRSWEDVPDATIQDSTDAVVRVDAVTICGTDLHILGGDVPEVTDGRILGH
EAVGTVVEVGDGVQTLAPGDRVLVSCITACGTCRFCRESRYGQCLGGGGWILGHLIDGTQ
AELVRVPYADNSTHRIPDGVSDEQMLMLADILPTSYEVGVLNGRLRPADVVVVIGAGPIG
LAAILAARLFSPSRIVAVDLADSRLDAAKAFGANIVVNSGRDDVATVVRDLTGGLGADVT
VEAVGYPETFEQAVALVRPCGHVANIGVHGKPATLHLEDIWIKNLTITTGLVDTYSTPTL
IGLVSSGQLDTSPMITHRFALDEFEQAYDVFSRAGETGALKVLLTAGS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactggtgttccacgggccggggaagcgatcctgggaggacgttcccgacgca
accatccaggacagtaccgacgcggtggtgcgggtcgacgcggtcaccatctgcggcacc
gacctgcacatcctcgggggggatgtgcccgaggtgaccgacggccggatcctcggccac
gaggccgtcggcaccgtggtcgaggtgggggacggagtgcagacactcgctcccggcgac
cgagtgctcgtctcgtgtatcaccgcgtgcggtacgtgccgcttctgtcgcgagagccgg
tacgggcagtgcctcggcggcggcggctggatcctcgggcacctgatcgacggcacccag
gccgaattggtccgagttccgtacgccgacaattcgacccaccgcattcccgacggcgtg
agcgacgagcagatgctcatgctcgccgacattctgcccacctcctacgaggtcggcgta
ctcaacggccgtctccggccggcggacgtcgtcgtcgtcatcggagccggacccatcggg
ctcgctgcgatcctcgccgcacgactgttcagtccgagccgcatcgtcgccgtcgacctc
gccgacagccggctcgacgcggcgaaggcattcggggcgaacatcgtggtcaacagcggt
cgcgacgacgtcgcgacggtcgtccgcgatctcacgggaggcctcggcgccgatgtcacc
gtggaggccgtcggctatcccgaaacgttcgaacaggcggtcgcgctcgtcaggccgtgc
ggacacgtcgcgaacatcggcgtgcacggcaaacctgcgaccctgcacctcgaggacatc
tggatcaagaacctgacgatcaccaccggcctggtcgacacctactcgacgcccacactg
atcggtctcgtgagcagtggtcagctcgacacgtcgccgatgatcacgcaccggttcgcg
ctcgacgagttcgaacaggcctacgacgtgttctctcgcgccggcgaaaccggtgcgttg
aaggtgctcctcaccgccggttcgtga

DBGET integrated database retrieval system