KEGG   Rhodococcus sp. p52: IM25_14640Help
Entry
IM25_14640        CDS       T05434                                 

Definition
(GenBank) protein glxC
  KO
K22082  methylamine---glutamate N-methyltransferase subunit B [EC:2.1.1.21]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00680  Methane metabolism
rhq01100  Metabolic pathways
rhq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    IM25_14640
Enzymes [BR:rhq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     IM25_14640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GXGXG
Motif
Other DBs
NCBI-ProteinID: AOD24406
UniProt: A0A1B2UJR7
LinkDB All DBs
Position
complement(3169725..3170423)
Genome map
AA seq 232 aa AA seqDB search
MTTDTLLPTATYDLATTTTRELNAALHAMEAPASIEVVNPQGAHALACGLNRPIDVRIDG
HVGYYAAGMNQHAHVTIDGNAGVGVAENMMSGSVRVTGDASQSAGATAHGGLLVIEGNAA
ARCGISMKGVDIVVGGDIGHMSAFMGQAGRLVVLGDAGEALGDSLYEVRIYVRGSVASLG
ADCVKKEMLPEHIAELQELLDTAGFDADPAEFTRYGSARQLYHFHVDNASAY
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgataccctgctcccgaccgccacctacgacctggcgacgaccactacccgc
gaactcaatgcggcactgcacgcgatggaggccccggcctcgatcgaggtggtgaacccg
caaggcgcccacgcactcgcctgcggcctgaaccggccgatcgacgtccgcatcgacggc
cacgtcggctactacgcagccgggatgaaccagcacgcccacgtgaccatcgatggcaac
gccggcgtcggggtcgcggagaacatgatgtcgggcagtgtgcgcgtcaccggcgacgcc
tcgcagtccgccggtgcgaccgcccacggcgggctgctggtcatcgaaggcaatgccgcc
gcacgctgcggcatctcgatgaagggcgtcgacatcgtcgtcggcggtgatatcggtcac
atgagcgccttcatgggacaggccggccgactcgtcgtcctcggcgatgccggtgaggcc
ctgggcgattcactgtacgaggtgcggatctacgtgcggggcagcgtcgcctcgctcggt
gcggactgcgtcaagaaggagatgctccccgagcacatcgccgagctgcaggaactgctc
gacacggccggtttcgacgccgacccggccgagttcacccgctacggctcggcccggcag
ctctaccacttccacgtcgacaacgcttcggcctactga

DBGET integrated database retrieval system