KEGG   Rhodococcus sp. p52: IM25_20785Help
Entry
IM25_20785        CDS       T05434                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00970  Aminoacyl-tRNA biosynthesis
rhq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IM25_20785
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rhq03029]
    IM25_20785
Enzymes [BR:rhq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     IM25_20785
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     IM25_20785
Mitochondrial biogenesis [BR:rhq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    IM25_20785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AOD23714
UniProt: A0A1B2UI19
LinkDB All DBs
Position
complement(4495512..4497020)
Genome map
AA seq 502 aa AA seqDB search
MTASVSADLLAYDDVLAKFEPVMGMEVHVELHTATKMFCGCPTTFGAEPNTQVCPVCLGL
PGALPVVNQAAVESAIRIGLALNCSITPWGRFARKNYFYPDQPKNYQISQYDEPIATDGY
LDVVLDDGTTWRVDIERAHMEEDTGKSLHVGGATGRIHGASHSLLDYNRAGVPLVEIVTK
PIVGAGERAPEVARAYVTALRDLLEALDVSDVRMDQGSMRCDANISLMPIGAKEFGTRTE
TKNVNSLKSVEVAVRYEMRRQAAVLVSGGEVIQETRHFQEADGTTSPGRRKETAEDYRYF
PEPDLEPIAPDAAWVEELRATLPELPWLRRARIQADWGVSDEEMRDLVNAGALDLVIATT
EAGAPASEARSWWVAYLAQQANTRGVELAELPITPEQVARVIALVADGKLTNKLARQVVD
GVLAGEGEPDEVVAARGLEVVRDDSALQAAVDAALAANPDIADKIRSGKVQAAGKIVGDV
MKATRGQADPARVKELVIAACS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctccgtgtccgctgacctgctcgcctacgacgacgtgctcgcgaagttcgag
cccgtgatgggcatggaggtgcacgtcgagctgcacaccgccaccaagatgttctgcggc
tgcccgaccaccttcggcgccgagcccaacacgcaggtgtgtccggtctgcctcggtctg
ccgggggcgctgcccgtcgtcaaccaggccgcggtcgagtccgcgatccgcatcggcctc
gcgctgaactgctcgatcaccccgtggggtcgcttcgcgcgtaagaactacttctacccg
gatcagccgaagaactaccagatttcgcagtacgacgagccgatcgccaccgacggatat
ctcgatgtcgtactcgatgacggcaccacctggcgggtcgacatcgagcgcgcgcacatg
gaggaggacaccggcaagtcgctgcacgtcggtggcgccaccggtcgcatccacggtgcg
agccactcgctgctcgactacaaccgcgccggtgtgccgctcgtcgagatcgtcaccaag
ccgatcgtcggtgccggcgagcgcgcccccgaggtcgcccgcgcctacgtcaccgccctg
cgcgacctgctcgaggcactcgacgtctccgacgtccgcatggaccagggttcgatgcgg
tgcgacgcgaacatctcgctgatgcccatcggcgcgaaggagttcggtacccgcaccgag
acgaagaacgtcaactccctcaagtccgtcgaggtggccgtgcgctacgagatgcggcgc
caggcggccgtactggtctccggtggtgaggtgatccaggagacccggcacttccaggag
gccgacggcaccacctcgcccggtcgccgcaaggagaccgccgaggactaccgctacttc
ccggagcccgacctcgagccgatcgcgcccgacgccgcctgggtcgaagagctgcgcgcg
acgctgcccgagctgccgtggctgcgccgcgcccgcatccaggccgactggggtgtctcc
gacgaggagatgcgcgacctcgtcaacgccggagcgctcgacctcgtcatcgcgaccacc
gaggccggcgcccccgcctcggaggcccgctcgtggtgggtcgcctacctggcccagcag
gccaacacccgcggtgtcgaactcgccgaactgcctatcacacccgaacaggtcgcccgc
gtcatcgcgctggtggccgacggcaagctgacgaacaagctggcccgtcaggtcgtcgac
ggtgtgctcgccggtgagggcgagcccgacgaggtggtcgccgctcgcggtctcgaggtc
gtgcgcgacgattcggcgctgcaggccgcggtcgacgccgcgctggccgccaaccccgac
atcgccgacaagatccgctccggcaaggttcaggcggccggcaagatcgtcggcgacgtc
atgaaggccactcgcggacaggccgatccggcgcgcgtgaaggaactcgtcatcgctgcg
tgcagttga

DBGET integrated database retrieval system