KEGG   Rhodococcus sp. p52: IM25_21015Help
Entry
IM25_21015        CDS       T05434                                 

Definition
(GenBank) ribonucleotide-diphosphate reductase subunit alpha
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00230  Purine metabolism
rhq00240  Pyrimidine metabolism
rhq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    IM25_21015
   00240 Pyrimidine metabolism
    IM25_21015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rhq03400]
    IM25_21015
Enzymes [BR:rhq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     IM25_21015
DNA repair and recombination proteins [BR:rhq03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    IM25_21015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC RNR_N Ribonuc_red_lgN
Motif
Other DBs
NCBI-ProteinID: AOD23755
UniProt: A0A1B2UHV4
LinkDB All DBs
Position
complement(4552300..4554465)
Genome map
AA seq 721 aa AA seqDB search
MTITDPAPATSAHLDDSLKDLDYHALNAMLNLYGPNGEIQFDKDVAAARQYFLQHVNQNT
VFFHNLDEKLDYLVEENYYEPEVLEKYSRAFVKSLFEHAYSKKFRFPTFLGAFKYYTSYT
LKTFDGKRYLERFEDRVCMVALTLADGDEILARHLVDEIISGRFQPATPTFLNSGKKQRG
EPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLSNIREHGAPIKKIENQSSGVIP
IMKLLEDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIP
DITFELAKKNEDMYLFSPYDVERVYGKPFADIDVTEKYYEMVDDKRIRKSKIKAREFFQT
VAELQFESGYPYVMFEDTVNRANPIAGKITHSNLCSEILQVSTPSEFNDDLSYSHVGKDI
SCNLGSLNIAKTMDSPDFAQTIEVAIRGLTAVSDQTTISSVPSIERGNNESHAIGLGQMN
LHGFLAREHIFYGSEEGVDFTNIYFYTVLFHALRASNKIAIERGSYFKGFPESKYASGEF
FDKYTDQVWEPATERVRQLFAESDIAIPTQQDWRELKESVQKHGIYNQNLQAVPPTGSIS
YINHSTSSIHPVASKIEIRKEGKIGRVYYPAPYMTNENLEYFQDAYEIGYEKIIDTYAAA
TQHVDQGLSLTLFFKDTVTTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTEVEGCVSCM
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattaccgatcccgctcccgccacgagcgcacacctcgacgattcgctcaaggat
ctcgactaccacgcgctcaacgcgatgttgaatctgtacggccccaacggcgagatccag
ttcgacaaggatgtggccgccgcccgtcagtacttcctgcagcacgtcaaccagaacacg
gtctttttccacaacctcgacgagaagctcgactacctcgtcgaggagaactactacgag
cccgaggtgctcgagaagtattcgcgcgcattcgtcaaatcgctgttcgagcacgcatat
tcgaagaagttccggttcccgaccttcctcggtgcgttcaagtactacacctcgtacacg
ctcaagacgttcgacggcaagcgctacctcgagcgtttcgaggaccgtgtgtgcatggtc
gcgctgacgctcgccgacggcgacgagatcctcgcccggcacctcgtcgacgagatcatc
tcgggtcgtttccagccggccaccccgaccttcctcaactcgggcaagaagcagcgcggc
gagcccgtttcgtgcttcctccttcgcatcgaggacaacatggagtcgatcggccgctcc
atcaactccgcactgcagctgtccaagcgcggtggcggtgtcgccttgctgctcagcaac
attcgtgagcacggcgctccgatcaagaagatcgagaaccagtcctccggcgtcatcccg
atcatgaagctgctcgaggactccttctcctacgccaaccagctcggtgcccgtcagggt
gccggtgcggtctacctgcacgcgcaccaccccgacatctaccgcttcctcgacaccaag
cgtgagaatgccgacgagaagatccgcatcaagaccctctcgctgggcgtcgtcatcccc
gacatcaccttcgagctggcgaagaagaacgaggacatgtacctgttctcgccgtacgac
gtcgagcgcgtctacggcaagcccttcgccgacatcgacgtcaccgagaagtactacgag
atggtcgacgacaagcgcatccgcaagtcgaagatcaaggcgcgcgagttcttccagacc
gtcgccgagctgcagttcgagtcgggctacccctacgtcatgttcgaggacacggtgaac
cgggccaacccgatcgccggcaagatcacgcactcgaacctgtgctcggagatcctgcag
gtctcgactccctcggagttcaacgacgacctgtcctacagccatgtgggcaaggacatc
tcgtgcaacctcggctcgctgaacatcgcgaagacgatggactcgcccgacttcgcgcag
accatcgaggtcgccatccgcggcctgacggccgtctccgaccagacgacgatctcgtcg
gtgccgtcgatcgagcggggcaacaacgaatcccacgccatcggcctcggccagatgaac
ctgcacggcttcctcgcccgcgagcacatcttctacgggtccgaagaaggcgtcgacttc
acgaacatctacttctacaccgtgctgttccacgccctgcgtgcgtcgaacaagatcgcg
atcgagcgcggctcgtacttcaagggcttcccggagtcgaagtacgcctcgggtgagttc
ttcgacaagtacaccgatcaggtgtgggagcctgccaccgagcgggtccgtcagctgttc
gccgagtcggacatcgcgatccccacgcagcaggactggcgcgagctgaaggagtccgtg
cagaagcacggcatctacaaccagaacctgcaggcggttccgcccaccggttcgatctcg
tacatcaaccactcgacgagctcgatccacccggtcgcgtcgaagatcgagatccgcaag
gagggcaagatcgggcgtgtctactacccggcgccctacatgacgaacgagaatctcgag
tacttccaggatgcatacgagatcggctacgagaagatcatcgacacctacgctgctgcg
acgcagcacgtcgaccaggggctgtcgctgacactgttcttcaaggacaccgtcaccacc
cgcgacgtgaacaaggcgcagatctacgcgtggcgcaagggaatcaagaccctgtactac
atccgcctgcggcagatggcgctcgagggcaccgaggtggagggttgcgtctcctgcatg
ttgtga

DBGET integrated database retrieval system