KEGG   Rhodococcus sp. p52: IM25_22330Help
Entry
IM25_22330        CDS       T05434                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00020  Citrate cycle (TCA cycle)
rhq00190  Oxidative phosphorylation
rhq00650  Butanoate metabolism
rhq01100  Metabolic pathways
rhq01110  Biosynthesis of secondary metabolites
rhq01120  Microbial metabolism in diverse environments
rhq01130  Biosynthesis of antibiotics
rhq01200  Carbon metabolism
Module
rhq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rhq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IM25_22330
   00650 Butanoate metabolism
    IM25_22330
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IM25_22330
Enzymes [BR:rhq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IM25_22330
    1.3.5.4  fumarate reductase (quinol)
     IM25_22330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like DAO FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: AOD23975
UniProt: A0A1B2UIK0
LinkDB All DBs
Position
4802640..4804391
Genome map
AA seq 583 aa AA seqDB search
MQEHRYDVVIVGAGGAGMRAAIEAGPRARTAVLTKLYPTRSHTGAAQGGMCAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEIMAKEAIDAVLDLEKMGLPFNRTPEGKIDQRRFGGHT
RDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDITLTETENGPVATGV
VAYELATGEIHVFHAKAIVFATGGSGRMYKTTSNAHTLTGDGLGIIFRKGLPLEDMEFHQ
FHPTGLAGLGILISEAVRGEGGILRNADGERFMERYAPTIKDLAPRDIVARSMVLEVLEG
RGAGPNKDYVYIDVTHLGEDVLEEKLPDITEFSRTYLGVDPVTELVPVFPTCHYVMGGIP
TNVDGEVLRDNENVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYANS
TKHVEMPEQPTKYVDDWLDLILHQGGKERVADIRTELQQTMDNNASVFRTEETLTQALND
IHELKKRYKEITVHDKGKRYNSDLLEALELGFLLEMAEVTVVGALNRKESRGGHAREDYP
KRDDENFLKHTMAYKVGEELISDIRLDYKPVVQTRYEPMERKY
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaacatcgttacgacgtagtcatcgtcggcgccggcggcgccggcatgcgtgcg
gccatcgaagccggcccgcgtgcgcgcaccgcagtgctcacgaagctctaccccacccgc
agccacaccggcgccgctcagggtggcatgtgcgccgccctcgcgaacgtcgaagaggac
aactgggagtggcacaccttcgacaccgtcaagggtggcgactacctggtcgaccaggac
gctgcggagatcatggccaaggaggccatcgacgccgttctcgacctcgagaagatgggt
cttccgttcaaccggacgcccgagggcaagatcgaccagcgtcgcttcggtggtcacacc
cgcgaccacggtaaggccccggtccgtcgcgcgtgctacgccgccgaccgcaccggccac
atgattctgcagacgctgtaccagaactgcgtcaagcacgacgtcgagttcttcaacgag
ttctacgcactcgacatcaccctcaccgagaccgagaacggtcccgtcgcgacgggtgtc
gtcgcgtacgagctcgcgaccggcgagatccacgtcttccacgccaaggccatcgtcttc
gcgacgggcggctcgggccgtatgtacaagacgacgtcgaacgcccacaccctcaccggt
gacggcctcggcatcatcttccgcaagggcctcccgctcgaggacatggagttccaccag
ttccatccgacgggcctggccggtctcggcatcctcatctcggaggccgtgcgcggtgag
ggcggcatcctccgcaacgccgacggcgagcggttcatggagcgctacgcccccaccatc
aaggacctcgcgccccgcgacatcgtcgcccgctcgatggtgctcgaggtgctcgagggt
cgcggcgccggaccgaacaaggattacgtctacatcgacgtgacccacctcggcgaggac
gtcctcgaggagaagctccccgacatcaccgagttctcccgcacctacctcggtgtcgac
cccgtcaccgagctcgtgcccgtgttcccgacctgccactacgtcatgggcggtatcccg
accaacgtcgacggcgaggtcctccgcgacaacgagaacgtcgtgcccggcctgtacgcg
gccggcgagtgcgcgtgcgtgtccgtccacggcgccaaccgtctcggcaccaactcgctg
ctcgacatcaacgtcttcggtcgtcgcgccggcatcgccgccgcggagtacgccaacagc
acgaagcacgtcgagatgcccgagcagccgacgaagtacgtcgacgactggctcgatctg
atcctgcaccagggcggcaaggagcgggtggccgacatccgcaccgagctgcagcagacg
atggacaacaacgcgtcggtgttccgcaccgaggagacgttgacgcaggcgctcaacgac
atccacgagctgaagaagcgctacaaggagatcacggtccacgacaagggcaagcgctac
aacagcgacctgctcgaggctctggagctcggcttcctcctcgagatggccgaggtcacc
gtcgtcggcgcgctgaaccgcaaggaatcgcgtggcggacacgcccgcgaggactacccg
aagcgcgacgacgagaacttcctcaagcacaccatggcgtacaaggtgggcgaggaactg
atctccgacattcgcctggactacaagccggtggtccagacccggtacgagcccatggag
cgtaagtactga

DBGET integrated database retrieval system