KEGG   Rhodococcus sp. p52: IM25_22335Help
Entry
IM25_22335        CDS       T05434                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00020  Citrate cycle (TCA cycle)
rhq00190  Oxidative phosphorylation
rhq00650  Butanoate metabolism
rhq01100  Metabolic pathways
rhq01110  Biosynthesis of secondary metabolites
rhq01120  Microbial metabolism in diverse environments
rhq01130  Biosynthesis of antibiotics
rhq01200  Carbon metabolism
Module
rhq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rhq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IM25_22335
   00650 Butanoate metabolism
    IM25_22335
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IM25_22335
Enzymes [BR:rhq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IM25_22335
    1.3.5.4  fumarate reductase (quinol)
     IM25_22335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_18 Fer4_9 Fer4_7 Fer4_16 Fer4_4 Fer4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AOD23976
UniProt: A0A1B2UIJ8
LinkDB All DBs
Position
4804391..4805167
Genome map
AA seq 258 aa AA seqDB search
MTTIEKTDTGASTLPPVPEGATMVTLKIARFNPEDDKGQHWDSFQVPALPSDRLLNLLGY
VKGYLDGTLTFRRSCAHGVCGSDAMRVNGVNRLACKILMKDMLDKNGKDVTITIEPIRGL
PVEKDLVVDMEPFFDAYRAVKPFLIASGNEPTRERIQSQADRARFDDTTKCILCACCTTS
CPVYWSDGSYFGPAAIVNAHRFIFDSRDEGASERLDILNDKEGVWRCRTTFNCTDACPRG
IQVTKAIQEVKRALMFAR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccatcgagaagaccgacacgggcgcgtcgacactgccacccgtgcccgagggc
gcgacgatggtcaccctcaagatcgcccggttcaacccggaggacgacaagggtcagcac
tgggattcgttccaggtgccggcgctgccgtccgaccgtctgctcaacctgttgggctac
gtcaagggttacctcgacggcacgctcactttccgtcgcagctgcgcccacggcgtgtgc
ggctcggacgcgatgcgtgtcaacggcgtcaaccgtctcgcctgcaagatcctcatgaag
gacatgctggacaagaacggcaaggacgtcacgatcacgatcgagccgatccgtggcctt
ccggtcgagaaggacctcgtcgtcgacatggagcccttcttcgacgcctaccgcgccgtg
aagccgttcctcatcgcctccggcaacgagccgacccgcgagcgtatccagtcgcaggcc
gaccgtgcccggttcgacgacaccaccaagtgcatcctgtgcgcgtgctgcaccacctcg
tgcccggtgtactggagcgacggcagctacttcggtcccgccgcgatcgtcaacgcgcac
cggttcatcttcgattcgcgtgacgagggtgcctccgagcggctggacatcctcaacgac
aaggaaggcgtgtggcgctgccgcaccaccttcaactgcaccgacgcgtgcccccgtggc
atccaggtgacgaaggcgatccaggaggtcaagcgcgcgctcatgttcgctcgctga

DBGET integrated database retrieval system