KEGG   Rhodococcus sp. p52: IM25_22365Help
Entry
IM25_22365        CDS       T05434                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rhq  Rhodococcus sp. p52
Pathway
rhq00020  Citrate cycle (TCA cycle)
rhq00480  Glutathione metabolism
rhq01100  Metabolic pathways
rhq01110  Biosynthesis of secondary metabolites
rhq01120  Microbial metabolism in diverse environments
rhq01130  Biosynthesis of antibiotics
rhq01200  Carbon metabolism
rhq01210  2-Oxocarboxylic acid metabolism
rhq01230  Biosynthesis of amino acids
Module
rhq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rhq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IM25_22365
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IM25_22365
Enzymes [BR:rhq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     IM25_22365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOD23981
UniProt: A0A1B2UIN3
LinkDB All DBs
Position
complement(4810572..4811789)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGKVVELDGDEMTRIIWQFIKDKLIHPYLDVDLEYYDLGVENRDATDDQVTVDA
ANAIKKHNVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPVIVGRHAFGDQYRATDFKVDRPGTVTITFTPEDGSEPIQHEVCQIPEDGGVVM
GMYNYKKSIQDFARASLSYGLQRNYPVYLSTKNTILKAYDGMFKDEFQRIYEEEFKAEFD
AAGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIEFAQQLE
DVVIKTVEAGQMTKDLALLVGPEQGWLTTEEFLAALDENLQKARA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaaggtaaggtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtggatctcgag
tactacgacctcggcgtggagaaccgcgacgccaccgacgaccaggtgacggtcgatgcg
gcgaacgccatcaagaagcacaacgtcggcgtcaagtgcgccaccatcacccccgacgaa
gcgcgtgtcgaggagttcggcctgaagaagatgtggcggtcgcccaacggcaccatccgt
aacatcctcggcggcaccatcttccgcgcgcccatcatcatctcgaacgtgccgcgtctg
gtgccgggctggaccaagcccgtcatcgtcggccgtcacgcgttcggcgatcagtaccgc
gccaccgacttcaaggtcgaccgcccgggcaccgtcaccatcaccttcacgcccgaggac
ggcagcgagccgatccagcacgaggtctgccagatccccgaggacggcggcgtcgtgatg
ggtatgtacaactacaagaagtccatccaggacttcgcgcgcgcctcgctctcgtacggc
ctgcagcgcaactacccggtctacctgtcgaccaagaacacgatcctgaaggcctacgac
ggcatgttcaaggacgagttccagcggatctacgaggaagagttcaaggcggagttcgac
gccgccggtctcacctacgagcaccgcctcatcgacgacatggtcgcatcgtccctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggctacggctcgctggggctgatgacctccgtcctgatgaccccggatggc
aagaccgtcgaggcggaggccgcacacggcaccgtcacccggcactaccgtcagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcctggacccgtggcctc
gagcaccgcggcaagctggacaacacccccgaggtcatcgagttcgcgcagcagctcgag
gacgtcgtcatcaagaccgtcgaagccggtcagatgaccaaggacctcgccctgctcgtc
ggccccgagcagggctggctgaccaccgaggagttcctcgcagcactcgacgagaacctg
cagaaggctcgcgcctga

DBGET integrated database retrieval system