KEGG   Rhizobium sp. 11515TR: CKA34_06150Help
Entry
CKA34_06150       CDS       T06097                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rhr  Rhizobium sp. 11515TR
Pathway
rhr00071  Fatty acid degradation
rhr00280  Valine, leucine and isoleucine degradation
rhr00281  Geraniol degradation
rhr00310  Lysine degradation
rhr00362  Benzoate degradation
rhr00380  Tryptophan metabolism
rhr00410  beta-Alanine metabolism
rhr00640  Propanoate metabolism
rhr00650  Butanoate metabolism
rhr00903  Limonene and pinene degradation
rhr00930  Caprolactam degradation
rhr01100  Metabolic pathways
rhr01110  Biosynthesis of secondary metabolites
rhr01120  Microbial metabolism in diverse environments
rhr01130  Biosynthesis of antibiotics
rhr01200  Carbon metabolism
rhr01212  Fatty acid metabolism
Module
rhr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CKA34_06150
   00650 Butanoate metabolism
    CKA34_06150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CKA34_06150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKA34_06150
   00310 Lysine degradation
    CKA34_06150
   00380 Tryptophan metabolism
    CKA34_06150
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKA34_06150
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CKA34_06150
   00281 Geraniol degradation
    CKA34_06150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKA34_06150
   00930 Caprolactam degradation
    CKA34_06150
Enzymes [BR:rhr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CKA34_06150
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CKA34_06150
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CKA34_06150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 NAD_binding_7 NAD_binding_8 UDPG_MGDP_dh_N 2-Hacid_dh_C FAD_binding_3 Pyr_redox_2 GIDA ApbA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ASW05503
UniProt: A0A248W310
LinkDB All DBs
Position
1253922..1256132
Genome map
AA seq 736 aa AA seqDB search
MAYTNFTVETDADGIALVTWDMPGKSMNVFTAEILEELNAIIDATVADAAVKGVVFTSGK
SSFSGGADLSMIKSMFSFYQEEKAKDPAVATQKLFDLVGRMTGLFRKLETCGKPWVSAIN
GTCMGGAFELSLACHGRVASSAKSVKIALPEVKVGIFPGAGGTQRISRLTDAQSALQMMT
TGQSLTAARAKAMNLVHQVVEPDQLIPAAKQMIKEGLKPIAPWDEKGFKAPGGGIWTPAA
AQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGLKIEQRYFTHVLQTTEAYSM
IRSLFISMQELGKGARRPAGQPKTELKKVGVVGAGFMGASIAYVTAAAGIPVTLIDRDIE
AATKGKGVGEGLVKDSIGKGRLTQDEGAALLSRITPSADYSDLKDVDLVIEAVFEDREVK
KAVIEAVEAVLPAGAVFASNTSTLPITGLAKNSKRPADFIGVHFFSPVEKMMLTEVILGK
ETGDHALAVALDYVAAIKKTPIVVNDTRGFFVNRCVFRYIHEAYDMLIEGVPAAMIENAA
KMAGMPVGPLALNDEVAIDLSYKILKATVADLGEKAVDPRHMQLISSLVEGEGRLGRKNS
KGFYDYPPKPAKKSLWPGLKDLYPQKKADEIDVNVLKQRFLVTIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGALSYIDGMGVKTFVDLCDKLAATYGPHFQPTALLMDMAANG
ETFYGRFDPYGVKKAA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacgaatttcaccgtcgaaaccgacgcagacggcatcgcgctcgtcacctgg
gacatgcccggcaagtccatgaacgtcttcaccgccgagatcctggaagagctgaacgcc
atcatcgatgccaccgttgccgatgcggccgtcaagggcgtggtcttcacctcgggcaaa
tcctccttctccggcggtgccgatctctcgatgatcaagtccatgttttccttctatcag
gaggaaaaggccaaggacccggccgttgccacgcagaagctcttcgatctcgtcgggcgc
atgaccggcctgttccgcaagctcgagacctgcggcaagccatgggtttcggccatcaac
ggcacctgcatgggcggcgctttcgaactgtcgctcgcctgccatggccgtgttgcgtcc
agcgccaagagcgtcaagatcgcgctgcccgaagtcaaggtcggcatcttccccggcgcc
ggcggcacgcagcgcatctcgcgcctgacggatgcacaatcggcgctgcagatgatgacc
acgggccagtcgctgacggcggcgcgcgccaaggcgatgaaccttgtgcatcaggtagtc
gagccggatcagctgatcccggccgccaagcagatgatcaaggaagggttgaagcctatc
gccccttgggacgagaagggcttcaaggcaccgggtggcggcatctggacgccggccgca
gcgcagctctggccggcagccccggccatcctacgccgtgagacatcgggcaactatcct
gcagccctcgccatccttaaatgcgtctatgaaggcctacaggtccccttcgataccggc
ctgaagatcgagcagcgctatttcacgcatgtgctgcagaccaccgaagcctattcgatg
atccgctcgctgttcatctccatgcaggaactcggcaagggcgcccgccgcccggccggc
cagccgaagaccgaactcaagaaggtcggcgtcgtcggtgccggcttcatgggtgcgtcc
atcgcctatgtcaccgcagcagccggcattccggtcacgctcatcgaccgcgatatcgaa
gccgcaaccaagggcaagggcgtcggcgaggggctggtcaaggattcgatcggtaaggga
aggctgacgcaggacgagggtgcagctctgctctcacgcatcacgccgtcggccgattat
tcggatctcaaggatgtggatctcgtcatcgaagccgtgttcgaggatcgcgaagtcaag
aaggccgtcatcgaggctgtcgaagccgtgctgccggccggcgccgtctttgcatccaac
acctcgacgctgccgatcacgggccttgcgaagaattccaagcggccagccgatttcatc
ggcgtccacttcttctcgccggtcgagaagatgatgctgactgaagtcattctcggcaag
gaaaccggcgatcatgcgctggccgtcgcgctggactacgtcgccgccatcaagaagacg
ccgatcgtcgttaacgacacgcgcggcttcttcgtcaatcgctgcgtcttccgctatatc
cacgaagcctatgacatgctgattgaaggcgtgcctgctgccatgatcgaaaacgccgcc
aagatggccggcatgccggtcgggccgctggcgctcaacgacgaggtcgccatcgatctc
tcctacaagatcctgaaggcgacggttgccgatctcggcgagaaggctgtcgacccgcgt
cacatgcaactgatcagcagtctcgttgaaggcgagggtcgtttgggccggaagaactcc
aagggtttctacgattacccgccgaagccggcaaagaagtcgctctggccgggcctgaag
gatctctatccgcagaagaaggccgatgagatcgatgtcaacgtgctgaagcagcgcttc
ctcgtcacgattgcgctggaagctgcccgcaccatcgaagaaggcatcgtcaccgatcca
cgcgaggccgatgtcggctccatcctcggcttcggtttcgcgccttataccggtggtgcg
ctgtcctacatcgacggcatgggcgtaaagaccttcgtcgatctctgcgataagctggca
gccacctacggcccgcatttccagccgacggcgctgctgatggacatggccgcgaatggc
gagaccttctatggacgtttcgatccctatggcgttaagaaggcggcttga

DBGET integrated database retrieval system