KEGG   Rhizobium sp. 11515TR: CKA34_10245Help
Entry
CKA34_10245       CDS       T06097                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rhr  Rhizobium sp. 11515TR
Pathway
rhr00970  Aminoacyl-tRNA biosynthesis
rhr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CKA34_10245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rhr03029]
    CKA34_10245
Enzymes [BR:rhr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CKA34_10245
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CKA34_10245
Mitochondrial biogenesis [BR:rhr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CKA34_10245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: ASW06226
UniProt: A0A248W4D3
LinkDB All DBs
Position
2104991..2106496
Genome map
AA seq 501 aa AA seqDB search
MTIVDVRTPDPKRFIPGATGDWEVVIGMEVHAQVLSKSKLFSGASTEFGNPQNSNVSLVD
AAMPGMLPVINEECVKQAVRTGLGLKAQINKRSIFDRKNYFYPDLPQGYQISQFKDPIVG
EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS
KPDIRSADEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV
NSIRFIGQAIEYEARRQIGILEDGGTIDQETRLFDPNKGETRSLRTKEDAHDYRYFPDPD
LLPLEFDDAFVAELAEHLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYFEAVAAGR
DGKMAANWVINDLLGALNRTGKSIEETPVSPAQLGAIIDLIKAETISGKIAKDLFEIVLN
EGGDPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVAKVKAKPTLAGWFVGQVMKSTG
GKANPQAVQALVKAKLGIEEE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtcgacgtccgtacgccagatccgaaacgcttcattcccggtgccaccggt
gattgggaagtcgttatcgggatggaagtccacgcccaggtgctgagcaagtccaagctc
ttctccggcgcctcgacggagttcggcaatccccagaattccaacgtgtcgctcgtcgat
gccgccatgcccggcatgctgcccgtcatcaacgaggaatgcgtcaaacaggccgtgcgc
accggtctcggtctgaaggcgcagatcaacaaacgttcgatcttcgaccgcaagaactat
ttctatcctgacttgccgcagggctatcagatctcgcagttcaaggacccgatcgtcggt
gagggcaagattgtgatctcgctcggtccggaccgtcagggccagttcgaggatatcgag
atcggcatcgagcgcctgcacctcgagcaggatgccggcaagtcgatgcacgatcagcac
gccaccatgtcttacgtcgatctgaaccgctccggcgtcgcgctgatggaaatcgtttcg
aagccggatatccgctcggccgacgaggcgaaggcctatatgacgaagctgcgctcgatc
gtgcgctatctcggcacctgcgacggcaatatggatgaaggctccatgcgcgccgacgtc
aacgtctcggtgcgccgcccgggcggcgaattcggcacgcgctgcgaaatcaagaacgtc
aactccatccgcttcatcggtcaggcgatcgaatatgaagcgcgccgtcagatcggcatt
ctggaagatggcggcacgatcgatcaggaaacccgcctgttcgatccaaacaagggcgag
acgcggtcgctgcgcaccaaggaagatgcgcatgactatcgctatttccccgatccggat
ttgctgccgctggaattcgacgacgctttcgttgcggagcttgcagagcatctacctgag
ctgcccgacgacaagaaggagcgtttcgtccgcgaactcggcctctcgatctacgacgct
tccgtgctcgtctcggaaaaggcgatcgccgattatttcgaagcggttgctgccggccgc
gacggcaagatggcggcaaactgggtcatcaacgacttgctgggcgctctgaacagaacg
ggcaaaagcattgaagagactccggtttcgcccgcccagctcggcgcgatcatcgatctc
atcaaggccgaaaccatctccggcaagatcgccaaggatctgttcgaaatcgtgctcaac
gaaggcggcgatcccgccgaaatcgtcgaggcccgcggcatgaagcaggtaaccgacacc
ggcgcgatcgaaaaggccgtcgatgagatcatcgccgccaacccggatcaggtcgccaag
gtcaaggcaaagccgacgctcgccggctggttcgtcggccaggtgatgaagtcgaccggc
ggcaaggccaacccgcaggccgttcaggcgctggtcaaggccaagctcggcatcgaagag
gaataa

DBGET integrated database retrieval system