KEGG   Rhizobium sp. 11515TR: CKA34_27545Help
Entry
CKA34_27545       CDS       T06097                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
rhr  Rhizobium sp. 11515TR
Pathway
rhr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rhr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CKA34_27545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhr02000]
    CKA34_27545
Transporters [BR:rhr02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    CKA34_27545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran RsgA_GTPase MMR_HSR1 DUF87 AAA_29 AAA_22 AAA_21 AAA_16 RuvB_N AAA_33 AAA_28 Cytidylate_kin IstB_IS21 AAA_23
Motif
Other DBs
NCBI-ProteinID: ASW09785
UniProt: A0A248WFG6
LinkDB All DBs
Position
p11515TR-B:complement(160719..162407)
Genome map
AA seq 562 aa AA seqDB search
MMSIVSALYPICRLFLAARGRLLLLGALLSALTVLAGVALLGLSGWFITATSLAGLTATA
ITFDVFAPSAGIRLLAILRTGARYGERLTTHDATLGVLATLRENLFRGWAAPGVATILMH
RPAKLLFRLTADIDALDSLYLRILVPAAVAIVSALAVSIALMLLSVPFGLLVGLWLVATG
LGIPALAGRLALIPARRRAHAIEALRSRVIDLVAGQTDLVMAGRLQAQCAALAAADYRLR
EADDTLNRIESGVVAGFGLASATLPSGTLLTITALAERGLIGAPVAALGLLVALAALEPF
AALRRGALELGRTVLAARRISPRLVQVARPPAHQMPPDGLAVQVSGVSARYDGAAMDSLE
NITLSLASDEHIAVIGPSGAGKSTLFAVLAGELAIECGVVETAPATTLTQRTALFQDSLR
DNLRLAAPDADDEMLYTALADAGLLQDVLALPKGLDTRLGEGGLGLSGGQSRRLALARLF
LLGTELWLLDEPTEGLDRETGRDVMQRIADRDRGRSLVIATHIRREAEIADRIVVLERGR
IVANVRRGETEFDAVLARLRQD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgatagtctccgctctttatcccatctgtcggcttttcctagcggcgcgggga
cgcctattgttgctcggcgcgctgctgtcggcccttaccgtgcttgccggcgtcgctttg
ctcgggctctctggttggttcatcacggcgacttcgcttgccggcctgacggcaacggcc
atcaccttcgatgtctttgccccgtctgccggcatcaggctgctggcgatccttcgcact
ggcgcacgctacggcgagcgcctgacgacccatgacgcgacgctcggcgttcttgccaca
cttcgcgaaaatctgtttcgcggttgggcagcgcccggcgtggcaacgattttgatgcat
aggcctgccaagctgctttttcggctgacggcggacatcgatgcgctcgactccctctat
ttgcgcattctggtgccggccgcggtcgcgattgtctccgctctggcggtcagcatcgcg
ctgatgctgctctcggtcccgttcgggctgctcgtcggcctatggcttgtcgctaccggt
cttggcattccggcccttgcaggacgtctggcgctgataccggcacggcggcgggcgcac
gcgatagaagcactgcgctcacgtgtcatcgatctcgtcgccggacagaccgacctcgtc
atggctggcagactgcaggcgcaatgcgcggcgcttgctgccgccgattatcgtttgcga
gaggcagatgatacgctgaaccggatcgaaagcggtgttgtcgccggcttcggcctcgcc
tcggccacgttgccgtccggcactttgctgacgatcaccgccttggccgaacgcggcctt
atcggagcgccggttgccgctctcggcctgctggtggcccttgcagcgctcgaacccttt
gcagcgctgcgccgaggagcgctggagctcggccgcaccgtgcttgctgcccgccgcatt
tcaccgcgtctggtacaggttgcacggccccccgcacatcagatgccgccagacggcctg
gccgtccaagtctccggcgtctccgcccgatatgacggagccgcgatggattcactcgag
aacatcacgctttccctggcatcggacgagcatatagcggtgatcggcccgagcggagcg
ggaaagtcgaccctgtttgccgtcctagccggtgaactcgccatcgaatgcggcgtggtc
gaaaccgctccggccacgacgctgacacagcgcaccgcgcttttccaggacagcctgcgg
gataacttgcgtcttgctgcgccggatgcagacgatgagatgctctacaccgcccttgcg
gatgccggcctcctgcaagacgtactggccctaccgaaaggcctcgacacccgcctcggc
gaaggcggtcttggtctgtccggcggacaatcccgtcgcctggcactcgcccgtctgttc
ctgcttggcacggagctctggcttctcgacgagccgactgaaggtctcgaccgcgaaacc
ggacgtgatgtcatgcagcgcattgccgaccgcgaccgcggccgttcgctggtcatcgcc
acgcatattcgccgcgaagccgagatcgccgaccggatcgtcgttctcgagaggggccgg
atcgtcgcgaatgtgcggcggggagaaaccgaatttgatgcagtgctcgcccggctgagg
caggactga

DBGET integrated database retrieval system