KEGG   Rhodococcus sp. PBTS 2: A3Q41_00828Help
Entry
A3Q41_00828       CDS       T05030                                 

Gene name
cysS
Definition
(GenBank) Cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A3Q41_00828 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhs01007]
    A3Q41_00828 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rhs03016]
    A3Q41_00828 (cysS)
Enzymes [BR:rhs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     A3Q41_00828 (cysS)
Amino acid related enzymes [BR:rhs01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   A3Q41_00828 (cysS)
Transfer RNA biogenesis [BR:rhs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    A3Q41_00828 (cysS)
 Prokaryotic type
    A3Q41_00828 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AMY22146
UniProt: A0A143QH34
LinkDB All DBs
Position
complement(843463..844878)
Genome map
AA seq 471 aa AA seqDB search
MTLHLHDTETRALREFTPLVPGHVSVYLCGATVQGEPHIGHVRSGVAFDVLRRWLLAHDY
DVAFVRNVTDIDDKILNKARDAGRPWWEWAATYERSFTWAYDRLGVLPPSAEPRATGHIT
QMVQMIERLIERGHAYADSCGDVYFDVQSFPSYGALSGHKLDDVHQGESVAEGKRDPRDF
TLWKGAKPGEPSWPTPWGPGRPGWHLECSAMAETYLGPDFDIHCGGLDLVFPHHENERAQ
SMAAGDGFSRYWLHNGWVTMGGEKMSKSLGNVLSVPNVLKKVRPQELRFYLGGAHYRSML
EYSDTALETAAVTYRGIEGFVRRAVERAGDVPMGKWTAGFAAALDDDLGVPKALAEIHAT
VTLGNTALESGDLPAAVEHAGSVRAMLDILGVDPLDPHWSSDSGSDAGALGALGVLVEAE
LERRATAKATKDWAVADEIRDRLAQAGVDVTDTPNGPEWSLGTSKTDEAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgacccttcacctacacgacaccgagacgagggccctgcgggaattcacccccttggtc
cctggccatgtatcggtgtacctgtgtggggcaacggtgcagggtgagcctcacatcggc
cacgtacgcagcggagtggcgttcgacgtcctgcgtcgctggctgttggcacacgactac
gacgtcgctttcgttcgcaacgtgacggacatcgacgacaagatcctgaacaaggcgcgc
gacgccggtcgtccgtggtgggagtgggcggcaacgtacgagcgttcgttcacctgggcc
tacgaccggctcggtgtgctgccgccgtccgccgaaccgcgtgcgacgggccacatcact
cagatggtccagatgatcgagcggctgatcgagcgtgggcacgcgtatgccgattcgtgc
ggagacgtgtacttcgacgtacagagtttcccgagttacggcgcgttgtccggtcacaag
ctcgacgacgtacaccagggcgagagcgttgccgagggcaagcgcgatcctcgcgacttc
acgctgtggaagggtgccaagcccggcgagccctcgtggccgacgccgtggggcccaggc
cgtcccggctggcatctcgagtgctcggcgatggcggagacctacctcggtccggacttc
gacatccactgcggcggtctcgatctcgtgttcccgcatcacgagaacgagcgagcccaa
tccatggcggccggcgacggcttctcgcgctactggttgcacaacggctgggtgacgatg
ggcggagagaagatgtccaagtctctcggcaacgtcctctcggtacccaacgtgctcaaa
aaggttcggccgcaagaacttcggttctacctcggtggcgcgcactatcgctcgatgctg
gaatactccgacactgcgctcgagaccgcggcggtgacgtaccggggcatcgaaggattc
gtccggcgagccgtcgaacgcgccggtgacgtaccgatgggcaagtggaccgccgggttt
gccgcggctctcgacgacgatctcggtgtgcccaaagcgttggccgagattcacgccacc
gtcaccctcggcaacaccgccctcgagtccggtgatctaccggcagccgtggagcatgcg
ggcagcgtgcgggcgatgctcgacatcctcggtgtcgaccccctcgatccgcactggtcg
agcgacagtggttcggacgcaggagctctcggtgcactcggcgttctcgtcgaggccgag
ctggagcgtcgagcaacggcgaaggcgaccaaggactgggccgtcgccgacgagatacgc
gatcgactggcgcaagccggagtcgatgtgacagatacacccaacgggcccgaatggtcg
ctgggtacgagcaagaccgacgaagcaggtttgtga

DBGET integrated database retrieval system