KEGG   Rhodococcus sp. PBTS 2: A3Q41_00892
Entry
A3Q41_00892       CDS       T05030                                 

Gene name
budC_2
Definition
(GenBank) Diacetyl reductase
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A3Q41_00892 (budC_2)
Enzymes [BR:rhs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     A3Q41_00892 (budC_2)
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     A3Q41_00892 (budC_2)
    1.1.1.-  
     A3Q41_00892 (budC_2)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 Ldh_1_N 3HCDH_N NAD_binding_2 TrkA_N Methyltransf_25 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AMY22210
UniProt: A0A143QGN5
LinkDB
Position
complement(905516..906283)
AA seq 255 aa
MSAVLVTGAGQGIGRAIALRLANDGHDIALVDLAEDKIAGVADEVRRTGSKATTFVADVS
DRDQVFAAVEHTHKALGGFDVIVNNAGIAQVAPLDDVRPEDTKKIWAVNVDGVLWGIQAA
AATFKALGQKGKIINASSIAGHDGFAMLGVYSATKFAVRALTQAAAKEYASDGITVNAYC
PGVVGTDMWVTIDKRFAELTGAAEGETYDKFVGGIALGRAQTPEDVAAFVSYLAGPDSDY
MTGQAPLIDGGLVYR
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagcgcggtgctggtgacaggggccggtcagggcatcggacgggcgatcgcgttgcga
ttggccaacgacgggcacgacatcgcgttggtcgacctggccgaggacaagatcgccggc
gtggccgacgaggtgcgtcgaacaggctcgaaggcaacgacattcgtcgccgacgtcagt
gatcgcgatcaagtgttcgcggccgtcgaacatacccataaagcgctcggcggcttcgac
gtcatcgtcaacaatgccggaatcgcacaggtcgcgccgctcgacgacgtccgcccggaa
gacacgaagaagatctgggccgtcaacgtcgacggtgtgctctggggaattcaagctgcg
gcagccacattcaaggcgctcggccagaagggcaagatcatcaacgcttcctcgatcgca
ggccacgacgggttcgcgatgctcggggtctacagcgcgacgaaattcgcggtccgggca
ttgacccaggctgcggccaaggagtacgcctcggacggcatcaccgtcaacgcgtactgc
cccggcgttgtcggcaccgacatgtgggtgaccatcgacaagcgcttcgccgagctgacc
ggtgccgccgagggggagacctacgacaagttcgtcggcggtatcgctctcggtcgggcg
cagactcccgaggacgtcgccgcgttcgtctcgtatctcgccggacccgactcggactac
atgaccggacaggcaccgttgatcgatggtggtttggtctaccggtga

DBGET integrated database retrieval system