KEGG   Rhodococcus sp. PBTS 2: A3Q41_01654Help
Entry
A3Q41_01654       CDS       T05030                                 

Gene name
aspC_1
Definition
(GenBank) putative aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00220  Arginine biosynthesis
rhs00250  Alanine, aspartate and glutamate metabolism
rhs00290  Valine, leucine and isoleucine biosynthesis
rhs01100  Metabolic pathways
rhs01110  Biosynthesis of secondary metabolites
rhs01130  Biosynthesis of antibiotics
rhs01210  2-Oxocarboxylic acid metabolism
rhs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3Q41_01654 (aspC_1)
   00290 Valine, leucine and isoleucine biosynthesis
    A3Q41_01654 (aspC_1)
   00220 Arginine biosynthesis
    A3Q41_01654 (aspC_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhs01007]
    A3Q41_01654 (aspC_1)
Enzymes [BR:rhs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     A3Q41_01654 (aspC_1)
    2.6.1.66  valine---pyruvate transaminase
     A3Q41_01654 (aspC_1)
Amino acid related enzymes [BR:rhs01007]
 Aminotransferase (transaminase)
  Class I
   A3Q41_01654 (aspC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMY22958
UniProt: A0A143QJJ8
LinkDB All DBs
Position
1680516..1681736
Genome map
AA seq 406 aa AA seqDB search
MTRSIDQARKLENVRYDIRGRILDKTEELEEQGHKILRLNVGNPAPFGFEAPDEIMMAMI
RNLPTAQGYSDSRGLFSARTAVVQYYQTKGLSDLDVGDVYLGNGVSELITMTMQALCNPE
DEVLIPSPDYPLWTGSVALAGGTPVHYLADETQDWAPDFEDLESKITTRTRAIVVINPNN
PTGAVYSRDVLQRFVDLAREHDLILLADEIYEKIVYDGSEMTNLATLTGKDVLCLTYSGL
SKAYRVCGFRAGWLAITGPRRRAASFIEGITLLSNMRMCANVPAQHAIQTALGGRQSIED
LLLPTGRLTAQRDLAHRMLNSIDGISCVQAAGALYMFPKLDTGRFGIVDDEKFVLDLLES
EKILVSHGRAFNWDVPDHFRLVTLPNVDDLSTALERLGNFMSSYSQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgatcgatcgatcaggcacgcaagctcgagaatgttcgctacgacattcgtggc
cgcatcctggacaagaccgaggaactcgaggagcaggggcacaagatcctgcgcctcaac
gtgggtaacccggccccgttcggtttcgaggcacccgacgagatcatgatggcgatgatt
cgcaatctgcctaccgcgcagggatattccgactcgcggggcctgttctcggcgcgcacc
gcggtggtgcagtactaccagaccaagggcctgagcgacctcgacgtcggcgacgtctac
ctgggcaacggggtctccgagctgatcaccatgacgatgcaggcgctgtgcaaccccgag
gacgaggtgctgatcccctcccccgattacccgctgtggacgggttcggttgctctcgcc
ggaggcactccggtccactatttggcagacgagactcaggactgggctccggacttcgag
gatctggaatcgaagatcaccacccgtacccgggccatcgtcgtgatcaatcccaacaac
cccactggtgcggtgtactcacgcgacgttctgcagcgtttcgtcgacctcgcgcgcgag
cacgatctgattctgctcgccgacgagatctacgagaagatcgtgtacgacggttccgag
atgaccaatctcgcaactctcaccggcaaagatgtgctgtgcctgacctattcggggttg
tcgaaggcctaccgagtgtgtggattccgtgccgggtggctggcgatcaccggtccacga
cgccgtgcggcgagcttcatcgagggcatcacgttgctgtccaacatgcgcatgtgcgcg
aatgtgcctgcacaacatgcaatacagacggcgctcggcggccgtcaatcgatcgaggac
cttctgctgccgacgggtcggttgaccgcgcagcgggatctggcgcatcgaatgctgaac
tccatcgacgggatcagctgtgtgcaggctgcgggcgcgctgtacatgttccccaagctc
gacaccggccgtttcggcatcgtcgacgacgagaagttcgtcctcgacctgctcgaatcc
gagaaaatcctggtcagtcacggtcgagcgttcaattgggatgtgcccgaccacttccgg
ctcgtcaccttgcccaacgtggacgatctctcgaccgcactcgagcggctcggtaacttc
atgagttcgtactcgcagtag

DBGET integrated database retrieval system