KEGG   Rhodococcus sp. PBTS 2: A3Q41_01804Help
Entry
A3Q41_01804       CDS       T05030                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rhs00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    A3Q41_01804
Enzymes [BR:rhs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A3Q41_01804
DNA repair and recombination proteins [BR:rhs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A3Q41_01804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AMY23107
UniProt: A0A143QL47
LinkDB All DBs
Position
complement(1822740..1825055)
Genome map
AA seq 771 aa AA seqDB search
MATLEIEGRKVSVTNLDKVLFPETSTTKSDIIEYYAAIAPAMLPHVAGRAVTRKRWPNGV
EQSSFFEKNLAASAPDWLDRRSMQHSDRVVTYPLFSTAADLVWLGQQAAIEAHVPQWRFD
GTEPGPATRMVFDLDPGDDVDLARCAEVACEIRDLIADIGMTAYPVTSGSKGIHLYVPLD
KPLSTSGASTVAKRVATLLEERSPDRVTATMAKAKRTGRVFVDWSQNNGKKTTVAPYSLR
GRSLPTVAAPRTWEELESRGLQQLRFEEVLERFHETGDLLADLDPKPAAEEHDTSGTDKL
GKYRSMRSSDRTPEPIPKTAEPQGNDDTFVIQEHHARRLHYDFRLEHDGVLVSWAVPKNI
PVETGQNRLAVHTEDHPLEYATFSGRIPKGEYGGGDVSIWDSGTYELEKWRDDEVIVVLH
GAKARGRFALIRTKGNQWLMHLMKDQPGQDSAHKKSQESPSTDKPVLKNISPMLATAGDI
LDLPEDEWSFEGKWDGFRIVAELTHGSMTLRTRSGNDYTEKFGAIGSLAEDLADHDAVID
GEVVVFDSNGISSFEKLQNAARDDIRFIAFDLLHLDGTSLVRKKYSDRRRLLELLTTGLD
SVLVPPLLTGSAADAIAESRERGWEGVVAKRTDSIYQPGKRAHTWIKYKNWRTQEVVIGG
WRRGQGRRSGGFGSLLMGIPDGDGLRYVGRIGTGFDDRALDSLAAALAPLETSESPFSTS
LPTADRRGAVWVEPVLVGEVRYYEATESGHLRHPSWRGLRPDKSPTDVVPE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctcgagatcgaaggccgaaaggtctccgtcaccaacctcgacaaggtgctg
ttcccagaaaccagcaccaccaaaagcgacatcatcgagtactacgctgccatcgccccg
gcgatgctgccgcacgtcgcaggacgcgccgtgacccgcaagcggtggccgaacggcgtc
gaacaatcctcgttcttcgagaagaatctcgccgcatccgcacccgactggctcgaccgc
cgatccatgcagcactccgaccgagtcgtcacctacccgttgttctccaccgcagcggat
ctcgtgtggctcgggcagcaggcggccatcgaagcgcacgtgccgcaatggcgattcgac
ggcaccgaacccggccctgccacccgcatggtcttcgacctcgatcccggcgacgacgtc
gacctcgcccgatgcgctgaggtggcctgcgaaatacgtgacctcattgcagacataggc
atgaccgcgtacccggtcaccagcggcagcaagggaattcacctgtacgtaccgctggac
aaaccgctgtcgacgtccggcgcatccaccgtcgccaaacgcgtcgccaccctgctcgaa
gaacggtcaccggatcgggtgaccgccacgatggcgaaagcgaagcgcacgggtcgagtg
ttcgtcgactggagtcagaacaacggaaagaagacaaccgttgctccgtactcacttcgg
ggccgttccctacccaccgtcgcggccccccgtacctgggaggagctcgaatcgcgaggg
ctgcaacaacttcgattcgaggaggttctggaacgattccacgaaaccggcgacctactc
gccgatctcgacccgaaaccggcagcggaagaacacgacacctccggcacggacaagctc
ggcaagtaccgcagcatgcgtagctcggaccgaactccggagcccatcccgaaaaccgcc
gagccccagggtaacgacgatacgttcgtgattcaggaacatcatgcccgacgcctgcac
tacgacttcaggctcgaacacgacggagtcctggtgtcgtgggccgtgcccaagaacatc
ccggtcgagaccgggcagaaccgtctggccgtccacaccgaggaccacccgctggaatat
gcgacgttctccggacgaatccccaagggcgagtacggcggcggtgacgtctcgatctgg
gacagcggaacctacgaactcgagaagtggagagacgacgaagtcatcgtcgttctgcac
ggagccaaagcacgcggcaggttcgccctcatccgcaccaagggcaaccagtggctcatg
cacttgatgaaagaccaacccggacaggacagtgcacacaagaaaagccaggagagcccg
tcgacggacaagccggtgctgaagaacatctcaccgatgcttgcaaccgcgggggacata
ctcgatctacccgaggacgagtggtcgttcgagggtaaatgggacggcttccgcatcgtc
gcggaattgactcacggttcgatgaccctgcgcacccgaagcggaaacgactacaccgag
aagttcggagccatcgggtctctcgccgaggacctggccgatcacgacgccgtcatcgac
ggtgaagtggtcgtcttcgacagcaacggcatcagcagcttcgagaagctacagaacgcc
gcccgcgacgacatccggttcatcgccttcgacctgctccatctcgacggcacgtccctc
gtgcgcaagaagtactccgaccggagacgattgttggaactgctcaccaccggcctcgac
tcggttctggtgccgccgttgttgacaggttcggctgccgacgccatcgccgagagccgt
gagcgggggtgggagggagtcgtcgccaagcggaccgattcgatctaccagccgggcaag
cgcgcccacacgtggatcaagtacaagaactggcgcacgcaagaagtggtgatcggcggt
tggcgacgcggccaggggcgtcgttccggcggattcggctcactgctgatggggatcccc
gacggcgacggtcttcgctacgtcggtcgcatcggcaccggtttcgacgatcgcgcgctc
gattcactggccgcagcgctggctccgctggaaacgtcggagagtcctttctccacgtcg
cttcccactgccgacagacgcggtgccgtatgggtggaaccggttctcgtcggagaagtg
cggtactacgaggcgacagaatccggccatcttcgccacccgagctggcgcggattgcga
ccggacaagtcgccgacggacgtcgttcccgagtag

DBGET integrated database retrieval system