KEGG   Rhodococcus sp. PBTS 2: A3Q41_01836Help
Entry
A3Q41_01836       CDS       T05030                                 

Gene name
ligC
Definition
(GenBank) DNA ligase C1
Organism
rhs  Rhodococcus sp. PBTS 2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMY23139
UniProt: A0A143QJM3
LinkDB All DBs
Position
1854381..1855430
Genome map
AA seq 349 aa AA seqDB search
MDLPLAVPVAPMLAKAAKVVPPQPEDGPPVWSYEPKWDGFRAIVFRDGDEVVLGSRGGKD
LARYFPELVEAVKAELPEKIVIDGEIVVPREKNGSTRLDWESLSERIHPAASRVTMLAEK
TPAQFIGFDLLAVGDEDLTGEPFSTRRARLLDAVGTGGPSCFVTSATDDAAVAEDWFERF
EGAGLDGVVAKKLDGPYLPNKREMIKIKHARTADCVLIGYRIHKSGNGIGSLLLGLYDGE
DLRMIGGASAFTDKRRLELLEELEPLRLGDDVTYDGEATRWNSSNDRNWIPVRIERVIEV
AYDQMEGARLRHVARFLRWRPDRDPRSCAYDQLEVPVRYDVADVIAGGR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggatcttcctctcgccgttccggttgcgccgatgctcgccaaagccgcgaaagtggtg
cctcctcagcccgaggacgggccgccggtgtggtcgtacgagcccaaatgggacggtttt
cgcgccatcgtgttccgcgacggcgacgaggtggtgctgggatcgcgcggcggcaaggac
ctggctcgctacttccccgagctcgtcgaggccgtcaaggccgaactacccgagaagatc
gtcatcgacggagagatcgtggtgccgcgcgagaagaacggttccacgcgcctggactgg
gagtcgttgtccgagcgcatccatcccgcggcgagccgagtgacgatgctggcggagaag
acaccggcgcagttcatcggcttcgatctgttggccgtcggcgacgaggatctgacgggt
gagccgttctcgacgcggcgggcgcgattgctcgacgcggtgggcacgggcgggccgagt
tgcttcgtcacctcggccaccgacgatgcggccgtggccgaggactggttcgagcggttc
gagggagcaggcctcgacggcgtcgtagcgaagaagctcgacgggccgtatctgcccaac
aagcgcgagatgatcaagatcaagcatgcccgtaccgccgactgcgtgttgatcggctat
cgaattcacaagtccggcaacggcatcggatcactactgctcggcctgtacgacggcgag
gatctgcgcatgatcggcggagcgtcggcgttcaccgacaagcggcggctggagttgctc
gaagaactcgaaccgctccggctcggtgacgacgtcacctacgacggcgaggcgacgcgt
tggaattcgtccaacgatcgcaattggattccggtgcgcatcgagcgggtcatcgaagtc
gcctacgaccagatggaaggcgcgcggctgcggcacgtggccaggttcctgcgatggcgc
ccggatcgcgacccccgctcgtgcgcctacgaccagctcgaggtgccggtgcgctacgac
gtcgccgatgtgattgctggaggtcgatag

DBGET integrated database retrieval system