KEGG   Rhodococcus sp. PBTS 2: A3Q41_02224Help
Entry
A3Q41_02224       CDS       T05030                                 

Gene name
adhT_2
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00010  Glycolysis / Gluconeogenesis
rhs00071  Fatty acid degradation
rhs00350  Tyrosine metabolism
rhs00625  Chloroalkane and chloroalkene degradation
rhs00626  Naphthalene degradation
rhs01100  Metabolic pathways
rhs01110  Biosynthesis of secondary metabolites
rhs01120  Microbial metabolism in diverse environments
rhs01130  Biosynthesis of antibiotics
rhs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3Q41_02224 (adhT_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3Q41_02224 (adhT_2)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A3Q41_02224 (adhT_2)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A3Q41_02224 (adhT_2)
   00626 Naphthalene degradation
    A3Q41_02224 (adhT_2)
Enzymes [BR:rhs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A3Q41_02224 (adhT_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N Methyltransf_11 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AMY23526
UniProt: A0A143QL72
LinkDB All DBs
Position
2257708..2258718
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTEFGGPLIVKDIPIPQPAPEQVLVKMETCGVCHTDIHAAQGDWPAKPTLPFVPG
HEGIGVIEAVGSQVSKDRIGERVAIAWLGSACGECDHCVSGWETLCETQQNSGYSIDGAY
AEYAVAHAKYVVHVPDGISSFDAAPLTCAGVTTYKAVKVGGVTPAQRVAIFGVGGLGHMA
VQYAKIAGGFVTAVDIEDEKLDLARELGADHTVNSATTDPVEAIQALGGADVAIVLAVIP
SVFDQAFRSLRRGGRLVCVSMPAHGVFPIPIFETVVGGISVLGSIVGTRKDLREVFALHE
AGRTTVSAVSRKLDEVNDCFDDLMAGRVTARQVLEF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgttgtcaccgagttcggcgggcccctaatagtcaaggacatcccgata
ccgcagcccgcgcccgaacaggtgctggtgaagatggagacgtgcggtgtgtgtcacacc
gatatccatgctgcgcagggggattggccggccaagccgaccttgcccttcgtccccggg
cacgagggcatcggagtgatcgaggcggtcgggtcgcaggtgtcgaaggacagaatcggt
gaacgggtcgccatcgcgtggctcggttcggcatgtggcgaatgcgatcactgtgtctcg
ggttgggagacgctgtgcgagacgcaacagaacagcggctactcgatcgacggtgcgtac
gccgaatacgctgtcgcccatgcgaagtatgtcgtccatgttcccgacgggatctcctcg
ttcgacgctgccccactgacctgtgccggcgtgaccacgtacaaggctgtcaaggtcggt
ggcgtcaccccggcgcagcgcgtggccatcttcggtgtcggcgggctcggtcatatggcg
gtgcagtacgccaagatcgccggcggcttcgtcaccgcggtcgatatcgaggacgaaaaa
ctcgacctcgcacgagaactcggcgcagaccacaccgtcaactcggcgacgaccgatccg
gtggaggcaattcaggcgctcggtggagccgatgtcgcaatcgtcctggccgtcatcccc
agtgtgttcgatcaggccttccggtcactgcgccgcggcggacggctggtgtgcgtgtcg
atgcctgcgcacggcgtgttcccgatcccgatcttcgagacggtggtcggcggaatctcg
gtcctcggctcgattgtcggcaccaggaaagatcttcgtgaggtgttcgcattgcacgag
gccggacgaacgacggtatcggcggtgtcgcgcaaactcgacgaggtcaacgactgcttc
gacgacctgatggccggacgcgtcaccgctcgtcaggtcttggagttctga

DBGET integrated database retrieval system