KEGG   Rhodococcus sp. PBTS 2: A3Q41_02347Help
Entry
A3Q41_02347       CDS       T05030                                 

Gene name
fadJ_3
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00071  Fatty acid degradation
rhs00280  Valine, leucine and isoleucine degradation
rhs00281  Geraniol degradation
rhs00310  Lysine degradation
rhs00362  Benzoate degradation
rhs00380  Tryptophan metabolism
rhs00410  beta-Alanine metabolism
rhs00640  Propanoate metabolism
rhs00650  Butanoate metabolism
rhs00903  Limonene and pinene degradation
rhs00930  Caprolactam degradation
rhs01100  Metabolic pathways
rhs01110  Biosynthesis of secondary metabolites
rhs01120  Microbial metabolism in diverse environments
rhs01130  Biosynthesis of antibiotics
rhs01200  Carbon metabolism
rhs01212  Fatty acid metabolism
Module
rhs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A3Q41_02347 (fadJ_3)
   00650 Butanoate metabolism
    A3Q41_02347 (fadJ_3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3Q41_02347 (fadJ_3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3Q41_02347 (fadJ_3)
   00310 Lysine degradation
    A3Q41_02347 (fadJ_3)
   00380 Tryptophan metabolism
    A3Q41_02347 (fadJ_3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3Q41_02347 (fadJ_3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A3Q41_02347 (fadJ_3)
   00281 Geraniol degradation
    A3Q41_02347 (fadJ_3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3Q41_02347 (fadJ_3)
   00930 Caprolactam degradation
    A3Q41_02347 (fadJ_3)
Enzymes [BR:rhs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A3Q41_02347 (fadJ_3)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A3Q41_02347 (fadJ_3)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A3Q41_02347 (fadJ_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 DAO NAD_binding_8 NAD_Gly3P_dh_N UDPG_MGDP_dh_N F420_oxidored adh_short_C2 2-Hacid_dh_C Pyr_redox_2 AlaDh_PNT_C GIDA
Motif
Other DBs
NCBI-ProteinID: AMY23648
UniProt: A0A143QLI4
LinkDB All DBs
Position
complement(2390767..2392959)
Genome map
AA seq 730 aa AA seqDB search
MSENMIAWERGADGIVVLTMDDAGKSANTMNDTYIASMAATVERLEAEKDAITGVVITSA
KKSFFAGGDLDDMTQDQGAVDERDVARALTERIDGIKSVLRRLETLGRPVVAAINGAALG
GGFEIALHTHHRIAADVPGTRIGLPEATLGLLPGGGGIVRTVRLMGLDAALSKVLTKGQQ
HSVADAKKLGLIDATVAGVDELIPAAKAWIAENTSAVQPWDVKGFEIPGGGPTDPAVAQN
LLAATALLRKQLKGAPAPAPRAILAAAAECASVDVDTADRIETRYFVSLMTDRVAQNMIR
AFFFDMQTIRRGTSRPAGHDTFTARSVAVIGAGMMGAAIAYVCAKAGIEVVLKDLDQNAA
DRGKLYAEKLEAKALERGSTTAERSAALLDRIRPTADATDCAAVDLVIEAAFESVEVKTA
VFGELDGIVPADIVLGSNTSQLPISILADGVSRPENFIGIHFFSPADKMPLVEIVRGRQT
SDATVAKVVDFVFQIGKTPIVVNDSRGFFTSRVIGAFLDEAMAAVGEGVNPVFVEQAGAQ
AGYPVPPLQLMDQVTLSLSQKIRKENERAMASEGKPPRRHGSDAVMDRMVDELDRPGRAG
GGGFYSYDESGARTGIWPGVRTSFDSGSTRIPFVDMQERMLFAEAIEAVKCLDDGVLTSV
ADANIGSLLGIGFPPWTGGVIQYIDQYDGGLSGFVDRARELASKYGAHFEPPQSLVNKAL
RGERVHTLVS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacatgatcgcatgggaacgcggtgccgacggcatcgtcgtactcacgatg
gacgacgcgggcaagagcgcgaacacgatgaacgatacgtacatcgcgtcgatggccgcc
acggtcgagcggctcgaagccgagaaggacgccatcaccggtgtcgtgatcacctcggcc
aagaagtcgttcttcgcgggcggcgacctcgacgacatgacgcaggaccagggcgctgtc
gacgagcgggacgttgcgcgcgccttgaccgagcggatcgacggcatcaagagtgttctc
cgacggctcgaaaccctcggccgcccagtagtggccgcgatcaacggcgcggccctcggc
ggcggcttcgagattgcgttgcacacccaccaccgcatcgcagcggatgtgccgggcacc
cgaatcggcctccccgaggccacgctcggattgttgcccggtggcggcgggatcgtcaga
acggtccgattgatgggactcgacgccgccctgtcgaaggtgttgacgaagggccagcag
cactcggtggccgatgcgaaaaagctcgggctgatcgacgccaccgttgccggtgtggac
gagttgattccggctgcgaaggcgtggatcgccgagaacacgtcggctgtgcagccgtgg
gacgtcaagggtttcgagatacccggtggcggaccgaccgatcctgccgtcgctcagaat
ctcctggccgcaacggcgctgctacgcaagcagctcaagggcgcacccgccccggcaccg
cgggcgatcctcgccgctgcggcggagtgcgcgtcggtcgacgtcgacactgcggatcgc
atcgaaacccgctacttcgtctctctgatgaccgatcgagtggcgcagaacatgattcgt
gcgttcttcttcgacatgcagaccatccgacgcggcacgtcccgcccggccggccacgat
acgttcaccgcccgttcggtcgcggtcatcggagccggaatgatgggtgccgcgatcgcc
tacgtgtgcgccaaggccggtatcgaggtcgtattgaaagacctcgaccagaacgctgct
gaccgcggaaagctctacgccgaaaaactcgaagcgaaagctctcgagcggggctcgacg
acggccgagaggtcggcggcactgctcgaccggatccggccgaccgcggacgcgaccgat
tgcgccgcagtcgatctcgtgatcgaagccgcattcgagtccgtggaggtcaagactgcg
gtgttcggggaactcgacgggatcgttcccgccgatatcgtcctcggctccaacacctct
cagcttcccatttctatcctggccgacggcgtgagccgacccgagaatttcatcggaatc
cacttcttctcccccgccgacaagatgcccctcgtcgaaatcgtccgtggccggcagact
tccgacgcgaccgtggcgaaggtcgtcgacttcgtgttccagatcggtaagacgcccatc
gtcgtcaacgacagtcgaggcttcttcacctcgcgagtaatcggcgcgttcctcgacgaa
gcgatggccgcggtcggcgagggcgtcaacccggtcttcgtcgaacaggcaggcgcgcag
gccggctaccccgtcccgccgctgcaattgatggaccaggtgaccttgtcgctgtcgcag
aagatccgcaaggagaacgaacgcgcgatggcgagcgaaggcaagccgcctcgccgacac
ggctcggacgcggtgatggacaggatggtcgatgaactcgaccgccccgggcgtgccggc
ggcggcggcttctacagctacgacgaatcgggtgcgagaaccgggatctggccgggcgtg
cgcacgtctttcgactcgggctcgactcgaattcccttcgtggacatgcaggaacggatg
ctgttcgccgaggcgatcgaggcggtcaagtgcctcgacgacggtgtgttgacgagcgtg
gccgacgcgaacatcgggtccttgctgggcatcggcttcccgccgtggaccgggggcgtg
atccagtacatcgaccaatacgacggcgggctgtccggcttcgtcgaccgagcacgcgag
ttggcatcgaagtacggggctcacttcgagccgccgcagtcgttggtgaacaaagcgcta
cgcggagagcgcgtccatacactcgtgtcctga

DBGET integrated database retrieval system