KEGG   Rhodococcus sp. PBTS 2: A3Q41_03076Help
Entry
A3Q41_03076       CDS       T05030                                 

Gene name
gabT_2
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00250  Alanine, aspartate and glutamate metabolism
rhs00280  Valine, leucine and isoleucine degradation
rhs00310  Lysine degradation
rhs00410  beta-Alanine metabolism
rhs00640  Propanoate metabolism
rhs00650  Butanoate metabolism
rhs01100  Metabolic pathways
rhs01120  Microbial metabolism in diverse environments
Module
rhs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A3Q41_03076 (gabT_2)
   00650 Butanoate metabolism
    A3Q41_03076 (gabT_2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3Q41_03076 (gabT_2)
   00280 Valine, leucine and isoleucine degradation
    A3Q41_03076 (gabT_2)
   00310 Lysine degradation
    A3Q41_03076 (gabT_2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3Q41_03076 (gabT_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhs01007]
    A3Q41_03076 (gabT_2)
Enzymes [BR:rhs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A3Q41_03076 (gabT_2)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     A3Q41_03076 (gabT_2)
    2.6.1.48  5-aminovalerate transaminase
     A3Q41_03076 (gabT_2)
Amino acid related enzymes [BR:rhs01007]
 Aminotransferase (transaminase)
  Class III
   A3Q41_03076 (gabT_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMY24367
UniProt: A0A143QPN2
LinkDB All DBs
Position
3152055..3153419
Genome map
AA seq 454 aa AA seqDB search
MASIEYRLPQERRIVTAFPGPKSSALAERRKAVVGAGVASTLPVYVADADGGVVVDVDGN
SLIDLGAGIAVTTVGASNPAVVAAVQDQVAHFTHTCFMIAPYEGYIAVAEKLAELTPGDH
DKRTVLFNSGAEAVENAVKIARHATGRSAVVVFDHAYHGRTNLTMALTSKSMPYKSGFGP
FAPEVYRVPMSYPFREGLGADGSAVTGAQAAARAISMIEKQVGADNLAAILIEPIQGEGG
FVVPADGFLPALTEWARKHDVVFIADEVQSGFTRTGAWFASEHEGIVPDLITMAKGIAGG
MPLAAVTGRADLIDAVHPGGLGGTYGGNPVACAAALASIEQMETLDLNARARDIERIVVD
RLTALMPEVGIMGEVRGRGAMLAVELVVPGGREPNPEATKAVAAAALAAGVIVLTCGTYG
NVIRLLPPLVISDELLDDALTVLENALRDASKGL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatcgaataccgacttccgcaggagcgcaggatcgtcaccgcgttccccggc
ccgaaatcgtcggctctggccgagcgccgcaaggccgtcgtcggtgcaggcgtcgcatcg
acgctgccggtgtacgtggccgacgcggacggcggcgtcgtggtcgacgtcgacggcaat
tcgttgatcgacctcggtgccggtatcgccgtgacgaccgtcggtgcgtcgaatccggct
gtcgttgccgccgtgcaggatcaggtcgctcacttcacgcacacctgcttcatgatcgcg
ccctacgagggatacatcgcggtcgccgagaagttggccgaactcaccccgggagatcac
gacaagcgcaccgtcctgttcaacagtggtgccgaggccgtcgagaacgcagtcaagatc
gcccggcacgccaccggccgctcggccgtggtcgtgttcgaccacgcgtatcacggccgc
acgaacctgacgatggctctgacctcgaagtcgatgccgtacaagagtggattcgggccg
ttcgctcccgaggtctatcgagttccgatgtcgtacccgttccgtgaaggactcggtgcc
gacggatcggccgtcaccggtgcacaggccgccgcccgtgcgatctccatgatcgaaaag
caggtcggcgcagacaatctcgcggccatcctgatcgagccgatccagggtgagggcggc
ttcgtcgtgccggcggacggcttcctgcctgcgctgaccgagtgggcgcgcaagcacgac
gtcgtgttcatcgccgacgaggtgcagtccggattcacccgcaccggtgcctggttcgcc
agcgagcacgaggggatcgtgccggacctgatcaccatggccaagggcatcgcgggcggt
atgccactggccgcggtgacgggccgggccgatctgatcgacgccgtgcatcccggtggg
ctcggcggcacctacggaggcaatcccgtcgcatgcgccgctgcgctggcatcgatcgaa
cagatggagaccctcgacctcaacgcccgcgctcgcgacatcgaacgcatcgtcgtcgat
cggctcacggcgttgatgccggaggtggggatcatgggtgaggttcgaggccgtggggcc
atgcttgccgtcgagctcgtcgtaccgggtggacgtgagccgaaccccgaggccaccaaa
gccgttgccgctgcggcactcgcggcaggcgtgatcgtgttgacgtgcggaacctacggc
aacgtcatccgcctgcttccgccgctggtgatctccgacgagttgctcgacgacgcactc
acggtcctcgagaacgcactgcgcgacgcttcgaagggactctga

DBGET integrated database retrieval system