KEGG   Rhodococcus sp. PBTS 2: A3Q41_03790Help
Entry
A3Q41_03790       CDS       T05030                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00010  Glycolysis / Gluconeogenesis
rhs00520  Amino sugar and nucleotide sugar metabolism
rhs01100  Metabolic pathways
rhs01110  Biosynthesis of secondary metabolites
rhs01120  Microbial metabolism in diverse environments
rhs01130  Biosynthesis of antibiotics
rhs01200  Carbon metabolism
Module
rhs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3Q41_03790 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    A3Q41_03790 (ppgK)
Enzymes [BR:rhs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     A3Q41_03790 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AMY25076
UniProt: A0A143QQL6
LinkDB All DBs
Position
complement(3941209..3942033)
Genome map
AA seq 274 aa AA seqDB search
MTQPGSDNSTAATAERHGFGVDVGGSGIKGGIVDLNTGELVGDRYKIETPQPSTPDAVAR
TVAEIVAHFEWTGPIGVTLPAVVTNGVARSAANIDKSWIDTDARALFADAIGNENITVLN
DADAAGVAEDKYGGGKGKDGVVVLLTFGTGIGSAVLHNGVLLPNTEFGHMEIGGKEAEHR
AASSVKENKGLSYKEWAKEVSTVLATFEALLWPDLFIAGGGISRKSEKWIPHLTNRTPVV
PATLLNTAGIVGAALAADSAVASAETGTSAGSPH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccaggttcggacaacagcaccgcggcgacggccgagcgtcacgggttcggc
gtcgacgtcggtggcagcggcatcaagggcggcatcgtcgacctgaacaccggtgagctc
gtgggcgatcgctacaagatcgagacgcctcagccctcgacccccgacgccgtcgcgcgg
accgtggccgagatcgtcgcgcatttcgagtggaccggaccgatcggcgtcaccctgccc
gcggtggtcaccaacggtgtggcgcgttcggccgcgaacatcgacaagagctggatcgac
accgatgcgcgagcattgttcgccgacgccatcggaaacgagaacatcaccgtcctcaac
gacgcggatgccgccggggtcgccgaggacaagtacggcggcggcaagggcaaggacggg
gtcgtcgttctgctcacgttcggcaccggcatcggttccgccgttctgcacaacggagtt
ctgctgccgaacaccgagttcggacacatggagatcggtggcaaggaagccgagcatcgc
gcggcgtcctcggtgaaggagaacaaggggctgtcctacaaggaatgggcaaaagaggtc
tccaccgtgctcgcaacgttcgaggcgctgctgtggcccgacctgttcatcgccggtggc
ggaatcagtcgcaagagcgagaagtggattccgcaccttaccaaccgaactccggtggtc
cccgcgaccctgctgaacacggcggggatcgtcggagcggccctcgcggcggacagtgcc
gtcgcgtccgccgagaccggtacatcggctggatcaccgcactga

DBGET integrated database retrieval system