KEGG   Rhodococcus sp. PBTS 2: A3Q41_04493Help
Entry
A3Q41_04493       CDS       T05030                                 

Gene name
davT
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
rhs00250  Alanine, aspartate and glutamate metabolism
rhs00410  beta-Alanine metabolism
rhs00640  Propanoate metabolism
rhs00650  Butanoate metabolism
rhs01100  Metabolic pathways
rhs01120  Microbial metabolism in diverse environments
Module
rhs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rhs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A3Q41_04493 (davT)
   00650 Butanoate metabolism
    A3Q41_04493 (davT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3Q41_04493 (davT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3Q41_04493 (davT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhs01007]
    A3Q41_04493 (davT)
Enzymes [BR:rhs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A3Q41_04493 (davT)
Amino acid related enzymes [BR:rhs01007]
 Aminotransferase (transaminase)
  Class III
   A3Q41_04493 (davT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMY25766
UniProt: A0A143QSJ7
LinkDB All DBs
Position
complement(4720931..4722205)
Genome map
AA seq 424 aa AA seqDB search
MAPMTASTRTHLSPALKQATPIVVDHGKGSWIIGTDGRKYLDFTTGIGVTSTGHCHPRVV
EAAREQVGKIIHAQYTTVMHQPLLALTDKLGEVLPAGLDSVFYANSGSEAVEASIRLARM
ATGRPNIVAFHGGFHGRTVAAASLTTAGTKFRSGFSPIMGGVHIAPFPYAFRYGWDMDTA
VAFALKELDYLLMTMSSPADTAAFIIEPVLGDGGYLPTPPAFLEGLRERADTHGIVLIVD
EVQAGVGRTGTFWGHQHSSITPDILITAKGLASGFPISAIAASAELMGKAWPGSQGGTYG
GNAVAAAAGVATLDVVREEGLVDNAAAQGRVLLDGLLALKEQHPAIGDARGLGLMQALEF
VDSSGNPDAAAALRVQQGAIDEGLLLLTCGALGNVVRIIPALIVSDDEMTFGLDALSRTL
KNVL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcacccatgacagcgtcgactcgcacccacctcagccccgcactcaagcaggcgacc
ccgatcgtcgtcgaccacggaaagggcagctggatcatcgggaccgacgggcgcaaatac
ctcgacttcaccaccggcatcggagtcaccagcaccggtcattgccatccccgcgtggtc
gaggcagctcgcgagcaggtgggcaagatcatccacgcccagtacacgaccgtcatgcat
cagcctctgctcgcgctgacggacaagctcggagaagtgttgcctgccgggttggacagt
gtgttctacgcgaactcgggatccgaggcggtcgaggcgtcgatccgattggcgcgcatg
gcaaccggtcgaccgaacatcgttgcattccacggcggcttccacgggcgaacggtggcg
gctgcatcgctcaccacggcgggaaccaagttccggtcgggattctcgccgatcatgggt
ggggtgcacatcgcaccgtttccgtatgcatttcggtacggatgggacatggacaccgca
gtcgccttcgcgctgaaggaactcgactacctgttgatgacgatgtccagccccgccgac
acggctgcgttcatcatcgagccggtgctgggcgacggcgggtacctgcccacgccccct
gcattcctcgagggcttgcgcgaacgcgccgacacccacggcatcgtcctgatagtcgac
gaggtgcaggccggagtcggacgcaccggaacgttctggggccatcagcactcgtcgatc
actcccgacatcctcatcaccgcaaaaggactcgccagcgggttcccgatctcggcgatc
gccgcatcggcagagctgatgggcaaggcatggccggggtcgcaaggcggaacctacggc
ggcaacgccgtcgctgctgcggcgggagtcgctaccctcgacgtcgtgcgcgaggaaggg
ctggtcgacaacgcggcagcgcagggccgagttctcctcgacggccttctcgcgctgaag
gaacagcacccggccatcggtgatgctcggggactcggattgatgcaggcgctcgaattc
gtcgacagctcgggcaatcccgacgccgccgctgctctgcgggtgcaacagggtgccatc
gacgaagggctgctgttgctcacctgcggtgcgctcggcaacgtggttcgtatcattcca
gcactgatcgtgagcgacgacgagatgacgttcggactcgacgcgttgtcgcggacattg
aagaacgtgctgtga

DBGET integrated database retrieval system