KEGG   Rhizobium sp. NT-26: NT26_0133Help
Entry
NT26_0133         CDS       T04765                                 

Gene name
idnD
Definition
(GenBank) L-idonate 5-dehydrogenase, NAD-binding
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
rht  Rhizobium sp. NT-26
Brite
KEGG Orthology (KO) [BR:rht00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NT26_0133 (idnD)
Enzymes [BR:rht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     NT26_0133 (idnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Shikimate_DH PrmA Methyltransf_11 AdoHcyase_NAD NAD_binding_7 DUF43
Motif
Other DBs
NCBI-ProteinID: CCF17858
UniProt: L0NA47
LinkDB All DBs
Position
132457..133500
Genome map
AA seq 347 aa AA seqDB search
MMLARFARLYGQRDLKVEEAPVAAPGAGQVLLKMAAGGICGSDLHYYQDGGFGPVRVREP
IIPGHEAAGYVEALGEGVSGLAVGQLVSVNPSQPCGHCRFCREGLPIHCLDMQFMGSAMR
LPHAQGMFRDWLVVPARQCVPVGETVTAGEAACAEPLAVCLHAVARAGDLNGKQVLVTGA
GPIGVLTVAAVRHAGAAKIVVTDLTDAALDRARAMGADQTINVATDAAALAAFEQDKGQF
DVAFECSAAAPAIRTAFATVRPRGLIVQVGVTGDVTVPLNALVGKELHWIGTQRFDQEFA
QAADLIGRRDIDVRPIISHSFPVTDAVKAFEQAGDRATACKVQLTFL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgcacggttcgcccggctttacggccagcgggacctgaaggtcgaggaggcg
cccgttgccgcacccggcgcgggtcaggtgctgctgaagatggcggccggtggcatctgc
ggctccgacctgcactactaccaggacggcggcttcggcccggtacgggtgcgggagccg
atcattccggggcacgaagcggcgggctatgtggaggcgctgggcgagggggtctctggg
ctggcggtcggccagttggtctccgtcaatccgagccagccctgcggacactgccgcttc
tgccgggaaggcctgcccatccattgcctcgacatgcagttcatgggcagcgccatgcgc
ctgccgcatgctcaaggcatgttccgcgattggctggtggtgccggcgaggcagtgcgtg
ccggtcggcgagacagtgacggcgggcgaggcggcttgcgccgaaccgctggcggtctgc
ctgcatgcagtggcgcgcgccggcgacctcaacggcaagcaggtgctcgtcactggcgcc
ggcccgatcggcgtgctgacggtggctgcggtccggcacgcgggtgcggccaagattgtg
gtgaccgacctgaccgatgccgcgctggatcgtgcccgagccatgggcgccgaccagacc
atcaacgtggcgacggatgctgcggccctcgcggccttcgagcaggacaaggggcagttc
gatgtcgccttcgagtgctcggccgcggcaccggcaatccgcacagcgtttgcgactgtc
cggccgcgtgggctcatcgtccaggtcggtgtgacgggcgacgtgacggtgccgctcaat
gccctggttggcaaggagctgcactggatcggcacccagcggttcgatcaggaatttgca
caggccgcggatctcatcggccgccgcgacatcgacgtgcggccgatcatctcccacagc
tttcccgtcacggatgcggtaaaggcgtttgagcaggccggcgaccgcgccaccgcctgc
aaggttcaactgacgtttctctga

DBGET integrated database retrieval system