KEGG   Rhizobium sp. NT-26: NT26_0505Help
Entry
NT26_0505         CDS       T04765                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00061  Fatty acid biosynthesis
rht00780  Biotin metabolism
rht01100  Metabolic pathways
rht01130  Biosynthesis of antibiotics
rht01212  Fatty acid metabolism
Module
rht_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NT26_0505 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NT26_0505 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NT26_0505 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rht01004]
    NT26_0505 (fabI)
Enzymes [BR:rht01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NT26_0505 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NT26_0505 (fabI)
Lipid biosynthesis proteins [BR:rht01004]
 Fatty acid synthase
  Component type
   NT26_0505 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CCF18229
UniProt: L0NBH4
LinkDB All DBs
Position
complement(526104..526922)
Genome map
AA seq 272 aa AA seqDB search
MVQASGLMAGKRGVIMGVANNRSIAWGIAKAIHAQGGEVAFTYQGDALRKRVEPLAAEIG
AVVAGDCDVGDEASIDAAFAEIEKLWGKIDFLVHAIGFSDKDELTGRYVDTTADNFDKTM
RISVYSFTSVARRAEKLMSDGGSMLTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDL
GPKNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIEEVGDVGLYLLSDLS
RSVTGEVHHADSGYHVVGMKAVDAPDISVIKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggttcaggcttcaggcctcatggcaggcaagcgcggcgtcattatgggcgtcgccaac
aaccgctcgatcgcttggggcattgctaaggccatccacgcacagggaggcgaggtcgcc
ttcacctatcagggcgatgcccttcgcaagcgggtcgaaccgcttgccgcagagatcggc
gccgtggttgccggcgactgtgatgtcggcgacgaagcaagcatcgacgccgcattcgcg
gagattgaaaagctgtgggggaagatcgatttcctcgttcacgccatcggcttttccgac
aaggatgaactgactgggcgctacgtcgacaccacggccgacaatttcgacaagacgatg
cggatctccgtctattcattcacatcggtggcgcgacgcgccgaaaagttgatgtcagac
ggcggctccatgctgaccctgacctattacggcgccgagaaggtcatgccgaactacaac
gtcatgggcgtggcgaaggcggcactggaggcgagcgtgaagtatctggcggtcgatctc
ggccccaagaatatccgcgtcaatgccatttcggcaggcccaatcaaaacgctggctgcc
tccggcatcggcgacttccgctacatcttgaagtggaacgagtacaacgcaccattgcgt
cgcacggtcaccatcgaggaagtgggcgatgtcggcctttacctgctgtccgacctgtcg
cgctcggttaccggcgaagtccaccatgccgacagcggttatcatgtcgtcggcatgaaa
gccgtcgatgctccggacatctccgtcatcaaggattga

DBGET integrated database retrieval system