KEGG   Rhizobium sp. NT-26: NT26_0799Help
Entry
NT26_0799         CDS       T04765                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase, iron/manganese cofactor
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rht  Rhizobium sp. NT-26
Brite
Enzymes [BR:rht01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NT26_0799 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCF18523
UniProt: L0NBN1
LinkDB All DBs
Position
819392..819994
Genome map
AA seq 200 aa AA seqDB search
MAFVLPELPYAYDALAPYMSAETLEYHHDKHHKAYVDTGNKLASEAGMGDLSVEEVIKKS
YGTHQTLFNNAGQHYNHIHFWNWMKKDGGGTKLPGKLQQAIDSDLGGYDKFKSDFVAAGT
TQFGSGWAWLSVKNGKLEISKTPNGENPLVHGADPILGVDVWEHSYYIDYRNARPKYLEA
FVDNLINWDYVLERYEVATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgtacttcccgaactcccctacgcctacgacgcgctggcgccctacatgtcg
gcggagacgctggaataccaccacgacaagcaccacaaggcctatgtggacaccggcaac
aagctggcctccgaggcaggcatgggcgatctctccgtcgaagaggtcatcaagaagtcc
tacggcacgcaccagacgctcttcaacaatgccggccagcactacaaccacatccacttc
tggaactggatgaagaaggatggcggcggcacgaagcttccgggcaagctgcagcaggcg
atcgacagcgatctcggcggctacgacaagttcaagtcggatttcgttgcggcgggcacc
acccagttcggctcgggctgggcatggctttcggtgaagaacggcaagctggaaatctcc
aagaccccgaacggcgagaacccgctggttcacggtgctgatccgatcctcggcgtcgat
gtctgggagcactcctactatatcgactaccgcaacgcccgtccgaagtacctcgaagcc
ttcgtcgacaacctgatcaactgggactacgtgctcgagcgctacgaagttgccacgaag
tag

DBGET integrated database retrieval system