KEGG   Rhizobium sp. NT-26: NT26_1481Help
Entry
NT26_1481         CDS       T04765                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
rht  Rhizobium sp. NT-26
Brite
KEGG Orthology (KO) [BR:rht00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rht03012]
    NT26_1481 (tufB)
   03029 Mitochondrial biogenesis [BR:rht03029]
    NT26_1481 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rht04147]
    NT26_1481 (tufB)
Translation factors [BR:rht03012]
 Eukaryotic Type
  Elongation factors
   NT26_1481 (tufB)
 Prokaryotic Type
   NT26_1481 (tufB)
Mitochondrial biogenesis [BR:rht03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NT26_1481 (tufB)
Exosome [BR:rht04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NT26_1481 (tufB)
  Exosomal proteins of breast cancer cells
   NT26_1481 (tufB)
  Exosomal proteins of colorectal cancer cells
   NT26_1481 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: CCF19205
UniProt: L0NDS7
LinkDB All DBs
Position
1439912..1441087
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPVEDVFSISGRGTVATGRVERGVIKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGIERGQVLCKPGSVKPHK
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgagcggacgaagccgcacgtcaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcagcgatcacgaagtacttcggcgagttcaag
gcgtatgaccagatcgacgccgctcctgaagagaaggcgcgcggcatcaccatctcgacg
gcgcacgtcgagtacgagacggccaaccgtcactatgcgcacgtcgactgccccggccac
gccgactacgtgaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtc
tgctcggctgccgatggcccgatgccgcagacccgcgagcacatcctgctcgcccgtcag
gttggcgttccggcgatcgtcgtgttcctcaacaaggtcgaccaggtcgacgacgcagaa
cttctcgaactcgtcgagctggaagtgcgcgaactcctgtcgtcctacgacttcccgggc
gacgacattccggtcgtcaagggctcggctcttgctgccctggaagattcggacaagaag
atcggtgaagacgcgatccgcgagctgatggctgctgtcgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccggtcgaagacgtgttctcgatctcgggc
cgcggcacggttgccacgggtcgcgtcgagcgcggcgtcatcaaggtcggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgtcgagatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgcttcgcggtgtcgac
cgcaacggcatcgagcgtggtcaggttctctgcaagccgggttcggtcaagccgcacaag
aagttcaaggcagaagcctacatcctgacgaaggaagagggcggccgtcatacgccgttc
ttcacgaactaccgtccgcagttctacttccgcacgacggacgtgacgggcatcgtgacg
cttccggaaggcacggaaatggtcatgcctggcgacaacgtcacggttgacgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgccatccgcgaaggcggccgcacc
gtcggcgccggcatcgtcgcatcgatcatcgagtaa

DBGET integrated database retrieval system