KEGG   Rhizobium sp. NT-26: NT26_1595Help
Entry
NT26_1595         CDS       T04765                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NT26_1595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rht02000]
    NT26_1595
Enzymes [BR:rht01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NT26_1595
Transporters [BR:rht02000]
 Other Transporters
  Pores ion channels [TC:1]
   NT26_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CCF19319
UniProt: L0NEL4
LinkDB All DBs
Position
complement(1536709..1537335)
Genome map
AA seq 208 aa AA seqDB search
MSDELILYTNPMSRGRIARWMLEEVGIPYRREVLTFGGTMKAPDYLRLNPMGKVPTLVHG
DSIVTECPAICAYLADAFPQAGLAPPQRERADYYRWLFFAAGPLEAAVSNRAVGFQVPED
RRAMIGYGSYAEVIETLENVLTDRSYIAGSSFTAADVYVGSHLMWGMQFGSIDKRPAFEA
YVRHLHDRPAHLRATELDDADMKEVQAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgaactcattctctataccaatcccatgtcacgcgggcggattgcccggtgg
atgctggaagaggtcggcattccctaccgccgggaggtgctgaccttcggcggcacgatg
aaggcaccggactatctgcgccttaatccgatgggaaaggtcccaaccctggttcatggt
gacagtatcgtgacggaatgcccggccatatgcgcatatctggcggatgccttcccgcaa
gcagggctagcgccgccgcaaagggagcgggccgactattatcgctggctcttcttcgcg
gccggcccgctggaggcggctgtcagcaatcgtgccgtcggcttccaggtccctgaggat
cgtcgtgccatgatcggatacgggagttatgcggaggtcatcgagacgctcgaaaatgtg
ctcaccgaccgcagctacatcgccggcagcagcttcacggcggccgacgtctatgtcggc
tcgcacctgatgtggggcatgcagttcggttcgatcgacaagaggccagcgttcgaggcc
tatgttcgccaccttcacgatcggccggcgcatttgcgggcgaccgaactggacgatgcc
gacatgaaggaagtgcaggcgggctga

DBGET integrated database retrieval system