KEGG   Rhizobium sp. NT-26: NT26_1620Help
Entry
NT26_1620         CDS       T04765                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00010  Glycolysis / Gluconeogenesis
rht00020  Citrate cycle (TCA cycle)
rht00620  Pyruvate metabolism
rht01100  Metabolic pathways
rht01110  Biosynthesis of secondary metabolites
rht01120  Microbial metabolism in diverse environments
rht01130  Biosynthesis of antibiotics
rht01200  Carbon metabolism
Module
rht_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT26_1620 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NT26_1620 (pdhC)
   00620 Pyruvate metabolism
    NT26_1620 (pdhC)
Enzymes [BR:rht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NT26_1620 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Ribosomal_60s Spore_IV_A QRPTase_N Peptidase_M23 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: CCF19344
UniProt: L0NEN7
LinkDB All DBs
Position
1562987..1564360
Genome map
AA seq 457 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEAVKVNALIAILAGEGEDVKDAAAAGGASAEAPKPAAAPAEAKAEAPKAEAAKPQ
AEQPVADAAPAASTPAPKAASGERIFASPLARRLAKEAGLDLSAVSGSGPHGRVVKADVE
KAAASGTAKAAPAAAAASQAAAPAMAKGPSDDAVLKLFAEGSYELLPHDGMRKTIASRLT
ESTQTVPSYTVSMDCELDALMKLRAEINASAPVKKTEKGEVPAFKLSVNDFIIKAMALAL
RDVPMANASWTSTARVLHKHADVGVAVAIPDGLITPIVRKAEQKTLSAISNEVKDLAKRA
RDKKLKPEEYQGGTTSVSNLGMYGVSSFTSIVNLPQASIVSIGAGVEKPVVRNGEIKIGT
VMTATFAFDHRVIDGALGAELASAFKRYVENPMAMLV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcaccatgcccgccctttctcccacgatggaagagggcaatcttgcc
aagtggctggtcaaggaaggcgacaaggttgcccccggcgacgtgattgctgagatcgag
accgacaaggcgaccatggaagtggaagccgtggatgaaggcacggtggcgaagatcgtc
gtcccggccggcaccgaggcggtcaaggtcaacgccctgatcgcaatcctcgccggtgaa
ggcgaggatgtgaaggacgccgctgccgccggtggggcatcggcggaagcaccgaagcct
gccgccgctccggccgaagccaaggcggaagcgccgaaagcagaagccgccaagccgcag
gcggagcagccggtagcagatgcggcgcccgcggcctcgacacctgcgcccaaggctgcc
tccggcgaacgcatcttcgcctcgccgctggcacgtcgtctcgccaaagaagccgggctc
gatctgtcggccgtttccggctcgggcccgcatggccgcgtggtcaaggcggacgtcgag
aaggctgcggcctccggtacggcgaaagccgcgccggctgctgctgccgcatcccaagcg
gctgcccctgccatggccaagggcccctcggacgatgcggtcctcaagctctttgccgaa
ggctcctacgaactcctgccgcatgacggaatgcgcaagacgattgcatcacgcctgacg
gaatcgacgcagaccgttccctcctacaccgtgtcgatggattgcgagctcgacgcgctg
atgaagctgcgcgccgagatcaacgcttcggctcccgtaaagaagacggagaagggcgag
gttccggccttcaagctctcggtcaacgacttcatcatcaaggcgatggccctcgcgctg
cgggacgtgccgatggcgaatgcctcctggacctcgacggcacgcgtgctgcacaagcat
gccgatgttggcgtggccgttgccattcccgacggcctgatcacgccgatcgtccgcaag
gccgagcagaagacgctgtccgccatctccaacgaggtgaaggatctcgccaagcgggcg
cgcgacaagaagctgaagcctgaggaatatcagggcggcacaacgtcggtttccaatctc
ggcatgtacggcgtctccagcttcacctcgatcgtcaacctgccgcaggcttcaatcgtc
tcgatcggcgccggcgtcgagaagccggtcgtcagaaacggcgagatcaagatcggcacg
gtcatgacggcaaccttcgccttcgatcatcgggtcatcgatggtgccctcggcgcggag
ctcgcctctgccttcaagcgctatgtcgaaaacccgatggcgatgctcgtctga

DBGET integrated database retrieval system