KEGG   Rhizobium sp. NT-26: NT26_1749Help
Entry
NT26_1749         CDS       T04765                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl c-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00340  Histidine metabolism
rht01100  Metabolic pathways
rht01110  Biosynthesis of secondary metabolites
rht01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NT26_1749 (hisI)
Enzymes [BR:rht01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     NT26_1749 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: CCF19473
UniProt: L0NEC4
LinkDB All DBs
Position
complement(1684858..1685319)
Genome map
AA seq 153 aa AA seqDB search
MIRDFPEPSSDKAEQEGPGALAPAFDANGLVTAVVTDAADGELLMVAHMNAEALALTIDT
GIAHYYSRSRRKIWKKGETSGNLQTVHDIRTDCDQDAIWLKVSVAGHDATCHTGRRSCFY
RIVEKQGDEGVLRIADDHRHFDPAQVYKPDGTK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgatttccccgagccctcttccgacaaggcggagcaggaaggccctggcgcc
ctggcacccgctttcgatgccaatggccttgttacggcggtcgtgaccgatgctgccgac
ggcgagcttctgatggtcgcccacatgaacgccgaggcgctggcactgaccatcgacaca
gggattgcccactattatagccgatcccgccggaagatctggaagaagggtgaaacctcc
ggaaacctgcagaccgtgcatgatatccgcacggactgcgaccaggatgccatctggctg
aaggtctcggtggccggacatgatgccacatgtcacactggtcgacgctcctgcttctat
cgtatcgtggagaaacagggggacgagggcgttctccggattgccgacgatcatcggcac
ttcgaccccgcccaagtctataaaccggatggaactaagtag

DBGET integrated database retrieval system