KEGG   Rhizobium sp. NT-26: NT26_2082Help
Entry
NT26_2082         CDS       T04765                                 

Definition
(GenBank) ABC transporter, substrate binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
rht  Rhizobium sp. NT-26
Pathway
rht02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rht00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NT26_2082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rht02000]
    NT26_2082
Transporters [BR:rht02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    NT26_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: CCF19806
UniProt: L0NG58
LinkDB All DBs
Position
complement(2017676..2018659)
Genome map
AA seq 327 aa AA seqDB search
MNKIVSAISTLAATALLAGAVEAADLVIYTSQPNEDAQATVDGFKVANPGLEVEWVRDGT
PKIMAKLMAEIEAGNPVADVLLIADTVTLERMKQAGQLLAYRSPEAKNLDASLYDADGHY
YSTKLITTGIMYNTQAGMKPASWKDLAKPEAKGLVAMPSPLTSGAALIHAQTLTGVNGLG
WDYYRQLKDNGAIAAGGNGAVLKSVASGEKAYGVVVDYLPIREKAKGAPVEFVFPEEGVS
AVTEPVAILSSTKHQEAARKFIDYILSDEGQKVQLDLGYIPAHDGLGVPAGFPPREEIKV
LPLNAADALKNSEQDLKSFSDIFDTAG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcgtctcagcaatctccactcttgcagccacagccctgcttgcgggcgct
gtcgaggccgcggatctcgtgatctatacaagccagccgaacgaggacgcgcaggccacc
gtcgacggtttcaaggtcgccaatcccggtctcgaggtcgaatgggttcgcgacggcaca
ccgaagatcatggcgaagctcatggccgagatcgaggccggaaatccggtcgcagacgtc
ctgctgatcgccgataccgtaacgctcgagcggatgaagcaggcggggcagctgcttgcc
tacaggtcgccggaggcgaagaatctggatgcgtccctctacgacgccgatggtcactac
tactccacgaagctgatcaccaccggcatcatgtacaacacccaggccggcatgaagccg
gcaagctggaaggaccttgccaagccggaagccaagggcctcgttgccatgccgagcccg
ctgacgtcgggtgcggccctcatccatgcccagacgctgaccggtgtcaacggcctgggc
tgggactactaccggcagctcaaggacaatggtgccatcgccgccggcggcaacggcgcc
gtgctgaagtcggtcgcctcgggcgagaaggcctatggcgtggtcgtcgactacctgccg
atccgcgaaaaggccaagggggcgccggtcgaattcgtgttcccggaagagggtgtttcg
gccgtgaccgagccggtcgcaatcctgtcctccacgaaacatcaggaagctgccaggaag
ttcatcgactacatcctctcggacgagggccagaaggtgcagctcgacctcggctatatc
ccggcccatgatggtctcggcgttccggctggcttcccgccgcgcgaggagatcaaggtt
ctgccgctcaatgctgcagatgccctgaagaactcggaacaggatctgaagtccttctcc
gatatcttcgacaccgccggctga

DBGET integrated database retrieval system