KEGG   Rhizobium sp. NT-26: NT26_2393Help
Entry
NT26_2393         CDS       T04765                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00240  Pyrimidine metabolism
rht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NT26_2393 (tdk)
Enzymes [BR:rht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     NT26_2393 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: CCF20117
UniProt: L0NIK3
LinkDB All DBs
Position
complement(2338469..2339059)
Genome map
AA seq 196 aa AA seqDB search
MAKLYFHYASMNAGKSTLLLQASYNYQERGMRTLILTAALDSRAGVGRVASRIGLGADAI
PFEAADDLFALVERMHGEETVACVFIDEAQFLAPEQVWQLARVSDRLGIPVMAYGLRTDF
QGKLFPGSQELLAIADELREVRTICFCGRKATMVARLDEEGQVVREGAQVDVGGNEKYVS
FCRRHWEEKIRYGEDT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctattttcactatgcgtcgatgaacgccggcaagtccacgctgctcctg
caggcttcctataactaccaggagcgggggatgcggacgctgatcctcaccgctgcgctc
gacagccgagccggcgtcgggcgcgtcgcctcgcgcatcgggcttggtgccgatgccatt
cccttcgaggcggccgacgacctgttcgcactggtcgagcgcatgcacggcgaggagacc
gtcgcctgtgtgttcatcgacgaagcgcagttcctggcgccggagcaggtgtggcagttg
gcgcgggtctcggaccggctcggcattccggtcatggcctatgggctgcggacggacttc
cagggcaagctcttccccggatcgcaggaactgctggcgatcgctgacgaattgcgggag
gtccgcacgatctgtttctgcggccgcaaggcgacgatggtggcgcggctggacgaagaa
ggtcaggtcgttcgcgagggggcccaagtcgacgtaggcggcaacgagaaatacgtctcc
ttctgccggcggcactgggaagagaaaatccgctacggtgaagatacttga

DBGET integrated database retrieval system