KEGG   Rhizobium sp. NT-26: NT26_2456Help
Entry
NT26_2456         CDS       T04765                                 

Gene name
betB
Definition
(GenBank) Betaine aldehyde dehydrogenase
Organism
rht  Rhizobium sp. NT-26
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCF20180
UniProt: L0NGJ7
LinkDB All DBs
Position
complement(2395001..2396470)
Genome map
AA seq 489 aa AA seqDB search
MNVMATPGTAFRAPEKFFIGGEWVAPRSSATLDVVSPVTEETILRYPEASVEDVHLAIAA
AREAFDKGPWPRMSPRERAGYLRKVAEHLRGRLDEIARAWTVQIGAPIMITSKLVGQNAQ
LFDFYADLIDGNAYAFEEERTRPGGGRTRIVKEPVGVCAAITPWNAPMVLLSYKIAAGLA
AGCTFVAKPSPETPLEAYILAEAIEAAGLPPGVFNLVPAGREVGDHLIRHPAIDKVAFTG
STPAGRHIAAACAERLTRVSLELGGKSAAILLDDADFAAALPSLMVYTMPITGQVCFALT
RILMPESRAQEFTDLYVGAVGNIKVGDPSDPSVHMGPLALGRQLDRVMDYIETGRKEGAK
LACGGGRPEGLEKGYFVQPTVFTEVTPEMTIAQEEIFGPVVSIITYTDEEDAIAKANDSI
YGLNGAIYSADPERAYRVARRIQSGHLSINGNIVDITMPFGGVKQSGLGREGGIEGLDNY
VEVKTVNFA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcatggccacgcccggaacggcctttcgcgccccggaaaagttctttatcggc
ggcgagtgggttgcaccccgctcatcggccacgctcgacgtggtctcgccggtcaccgaa
gagaccatcctgcgctatcccgaggcctcggtggaggatgtccatctcgcgatcgcggcc
gcccgcgaggcgttcgacaagggaccttggccacgcatgtcgccgcgtgagcgggccggc
tatctgcgaaaggtggcggagcacctgaggggccggctggacgagatcgcccgtgcctgg
acggtgcagatcggcgcgccgatcatgataacctcgaagctcgtcggccagaatgcgcag
cttttcgatttctacgccgatctcatcgacggcaatgcctatgccttcgaggaagaacgc
acacgacccggcggcggcaggacccggatcgtcaaggagccggtcggcgtctgcgcggcg
atcaccccctggaatgcgcccatggtgctcctgagctacaagatcgccgccgggctcgcg
gccggctgtacattcgtcgccaagccgtccccggaaactccgctcgaagcctatatcctg
gcggaggcgattgaggccgccgggctgccgccgggcgtcttcaacctcgtcccggcagga
cgggaggtcggcgaccatctgatccgccatccggcgatcgacaaggtagccttcacgggc
tcgacgcctgcgggacgccacatcgctgccgcctgcgccgagagactaacccgcgtcagc
ctcgaactcggtggcaagtccgccgcgatcctgctcgacgatgccgatttcgcggcggca
ctgccgagcctgatggtctacaccatgccgatcaccggacaggtctgctttgcgttgacg
cgcatcctcatgccggaaagccgggcacaggaatttaccgacctctatgtcggcgccgtc
ggcaatatcaaggtcggtgacccgtccgatccgagcgtgcacatgggcccgctcgcgctt
ggccgtcagctcgaccgggtcatggattatatcgagaccggccgcaaggaaggggcgaag
ctcgcctgcggcggcggacggccggaggggctggagaagggctatttcgtccagccgacg
gtgtttaccgaagtgacgccggagatgacgatcgcccaggaggagatattcggcccggtc
gtctcgatcatcacctatacggacgaggaggatgcgatcgccaaggccaacgacagcatc
tacgggctgaacggtgcgatctattcggccgatccggaacgggcctatcgggtggcgcgg
cgcatccagtctgggcacctgtcgatcaatggcaatatcgtcgacatcaccatgcccttc
ggcggcgtcaagcagtccggccttggccgcgagggcggtatcgaaggactcgacaattat
gtggaagtgaagaccgtcaacttcgcctga

DBGET integrated database retrieval system