KEGG   Rhizobium sp. NT-26: NT26_2522Help
Entry
NT26_2522         CDS       T04765                                 

Definition
(GenBank) putative glycosyl hydrolase, 13 family; Putative Maltose alpha-D-glucosyltransferase (trehalose synthase)
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00500  Starch and sucrose metabolism
rht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT26_2522
Enzymes [BR:rht01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NT26_2522
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     NT26_2522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CCF20246
UniProt: L0NHF5
LinkDB All DBs
Position
2449828..2451489
Genome map
AA seq 553 aa AA seqDB search
MISDLWYKNAVIYCLSVETFMDSNGDGVGDFEGLSRRLDYLAGLGVNAIWLMPFQVSPGK
DDGYDVADYYNIDPRYGTLGDFVDFTHGCKQRGIRVLIDLVVNHTSDQHPWFQSARRDPN
SPYRDWYLWSKKKPANADEGMIFPGVQESTWTYDEKAGAYYFHRFYEFQPDLNTANPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIAEKGADIKKPKEQFEMLRTFREFLQWRKGDSII
LGEANILPKENIRYFGDDGDRIQMMFNFPVNQSLFYALASGDTEPMVAALEQTREKPHTA
QFGMFLRNHDELDLGRLSEDQRQAVFAAFGPEKHMQLYDRGIRRRLAPMLGGDQRRLELA
YSLMFSLPGTPVIRYGDEIGMGDDLDLPERNCARTPMQWSDEPQGGFTKSDKPVLPVISK
GPFGFEHINVAEQRRDPESLLNWMERLIRMRKEVPEIGWGDYTVLDTGKPGVLAIRYDWR
NNSVLIVHNLKPEPVEIHLDVGCGEHGNLLIDIADSESSEADGKGRHRLLLEAHAYRWFR
VGGLDYLLRRTEL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagcgacctctggtacaagaacgccgtcatctactgcctgtcggtcgaaaccttc
atggattccaacggcgacggcgtcggggatttcgaggggctgtcgcgccggctcgactac
ctcgcggggcttggcgtcaatgcgatctggctgatgccgttccaggtctctcccgggaag
gatgacggctacgatgttgccgattactacaacatcgacccgcgctacggcacgctgggt
gatttcgtcgacttcacccatggctgcaagcagcgcggcatccgggtactgatcgatctc
gtcgtcaaccacacctccgaccagcatccctggttccagtcggcccgccgcgatccgaac
tcgccctatcgcgactggtacctgtggtcgaagaagaagccggcaaatgccgacgaggga
atgatctttccaggcgtccaggaaagcacatggacctatgacgagaaagcgggcgcatac
tacttccaccggttctacgagttccagccggacctcaataccgccaatccgcacgtccag
gcggagatcctcaagatcatgggcttctggatccagcttggcgtgagcggcttccgtatg
gatgccgtccccttcgttatcgccgagaagggtgcggacatcaagaagccaaaggagcag
ttcgaaatgctgcgtaccttccgcgaatttctgcagtggcggaagggggattcgatcatc
ctcggggaagcgaacatactgccgaaggaaaacatcaggtacttcggcgacgatggcgac
cgcatccagatgatgttcaattttcccgtcaaccagtcgctgttctatgcgctggcgagc
ggcgacacggaaccgatggtcgccgcactggagcagacgcgcgagaagccgcacactgcg
cagttcggcatgttcctgcgcaaccacgacgaactcgatctcgggcgtctgagcgaggat
cagcggcaggcggtctttgcggccttcgggcccgagaagcacatgcaactctacgaccgc
ggcatccgccggcggctcgcgccgatgctgggcggcgaccagcgccgtctggaactcgcc
tacagcctgatgttctcgctgccgggaacgcccgtcatccgctatggcgacgagatcggc
atgggcgatgacctggacctgccggagcgcaactgcgcccggacgccgatgcaatggtct
gacgaaccgcagggtggcttcaccaaaagcgacaagccggtgctgccggtgatctccaag
ggacctttcggcttcgagcacatcaacgtcgcggagcagcggcgcgatccggaatccctg
ctcaactggatggagcggctgatccgcatgcgcaaggaggtaccggagatcggctggggc
gactataccgtgctggataccggaaaaccgggtgtgctcgctatccgttacgactggcga
aacaattcggtcctgatcgtccacaacctgaagccggagccggtcgaaatccatctcgac
gtcggctgcggcgagcacggcaacttgctcatcgacatcgccgatagcgaaagcagcgag
gcggacggcaagggacgccaccgcctgctgctggaggcccatgcctatcgctggttccgg
gtcggcggcctggactatctgctgcgccgaacggaactttga

DBGET integrated database retrieval system