KEGG   Rhizobium sp. NT-26: NT26_2984Help
Entry
NT26_2984         CDS       T04765                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase FAD/NAD(P)-binding (aerobic)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00564  Glycerophospholipid metabolism
rht01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NT26_2984 (glpD)
Enzymes [BR:rht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NT26_2984 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CCF20708
UniProt: L0NHY0
LinkDB All DBs
Position
2897314..2898828
Genome map
AA seq 504 aa AA seqDB search
MNGPEFDIFVIGGGINGCGIARDAIGRGYKVALAEMNDFGAGTSSGSTKLIHGGLRYLEY
YEFRLVREALMEREVLWAMAPHIIWPLRFVLPFQKGGVRPAWLIRLGLFLYDHLGGRKLL
PPTRSLDMRRDPAGGPLKPLFTKAFEYSDGWVDDARLVVLNARDAADKGALILARTKVVS
ARRRDGFWSIEIEDQASGARRVITARMLVNAAGPWVDHVLSGAVEANARRNVRLVQGSHI
VVKKKFEGPRAYFFQNPDNRIIFAIPYEQDFTLIGTTDRDFEGDPKDVKISQGEIGYLCS
AASEYFSEPVTAQDIVWSYSAVRSLYDDGASKAQEATRDYVLKVDEANGAPLLNVFGGKL
TTYRRLAEHALEKIGEKIGTRGSPWTAKSRLPGGDFPVLGYEEQVRALAAAYPFLTDAHT
RRLVRSYGTAAAALLGDARSQRDLGHHFGSDLYAREVDWLMTREWAFRAEDILWRRTKQG
LRLSQEETNFLEEYMAAVPARSVG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgggccggaattcgacatattcgtgattggcggcggcatcaatggatgcgggatt
gcgcgcgacgccatcggccgcggatataaagttgcccttgccgaaatgaacgattttggc
gccggcacgtcctccggctccacgaagcttatccacggcggtctgcgctatctcgaatac
tacgagttcagactggtgcgagaagcattgatggagcgcgaggtcctgtgggcgatggcg
ccccatatcatctggccgctgcggttcgtcctgccattccagaagggcggcgtgcggccc
gcctggctgatccgcctcggccttttcctctatgatcatctgggtggcagaaagctgctg
ccgcccaccagaagcctggacatgcgacgggatccggctgggggcccgctgaagccgctg
tttacgaaggcgttcgagtattccgacggctgggtggatgacgcaaggctggtcgtgctc
aatgcacgcgacgcggctgacaagggtgccttgattctcgcgcggacgaaggtggtgtcg
gcccggcgaagagacggcttctggagcatcgaaatcgaagaccaggcgagcggggcaagg
cgcgtgattacggcgcgcatgctggtcaatgccgccggtccgtgggtggatcacgtgctt
tccggcgcagtggaggcgaatgcgcgtcgaaacgtgcggctggtacaaggcagccacatc
gtcgtgaagaagaaattcgaaggaccccgtgcctactttttccagaaccccgacaaccgc
atcatctttgccatcccctacgaacaggactttacgctgatcggaaccaccgatcgcgac
ttcgaaggcgacccgaaggacgtgaagatcagtcagggcgagatcggctacctctgctcg
gccgcaagcgagtatttttcggaaccggtgacggcccaggatattgtctggagctattcc
gcagtacgctcgctctatgacgacggtgcctccaaggcacaggaggcgacacgagactac
gtgctgaaagtcgacgaggcgaatggcgcccccctgttgaatgtgttcggcgggaagctg
accacctatcgacgccttgccgaacatgcgcttgagaagatcggcgagaagatcggcacc
aggggatctccatggaccgcgaaaagtcgcctgccgggcggagacttccctgtactaggc
tacgaggagcaggttcgagcgttggcggcggcctatccgttcctgactgacgcacataca
aggcgcctcgttcgttcctacggcacggcggcagccgcgctgctgggagatgcgcggagc
caacgggacctcggtcaccacttcggcagcgacctctatgcccgcgaagtggactggctg
atgacgcgggaatgggcatttcgcgcagaagacatcttgtggcgcaggaccaagcaggga
ctgcgcctgtcgcaggaagaaacgaattttttggaggaatacatggctgctgtgccggcg
aggtccgtcggctaa

DBGET integrated database retrieval system