KEGG   Rhizobium sp. NT-26: NT26_3496Help
Entry
NT26_3496         CDS       T04765                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00020  Citrate cycle (TCA cycle)
rht00190  Oxidative phosphorylation
rht00650  Butanoate metabolism
rht01100  Metabolic pathways
rht01110  Biosynthesis of secondary metabolites
rht01120  Microbial metabolism in diverse environments
rht01130  Biosynthesis of antibiotics
rht01200  Carbon metabolism
Module
rht_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rht_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rht_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT26_3496 (sdhA)
   00650 Butanoate metabolism
    NT26_3496 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NT26_3496 (sdhA)
Enzymes [BR:rht01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NT26_3496 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     NT26_3496 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: CCF21218
UniProt: L0NJF9
LinkDB All DBs
Position
complement(3422129..3423982)
Genome map
AA seq 617 aa AA seqDB search
MASITPIAQGTSQTGKAYTYVDHSYDVIVVGAGGAGLRATLGMAEQGFKTACITKVFPTR
SHTVAAQGGIAASLTNMTPDCWQWHLYDTVKGSDWLGDVDAMQYLAMEAPKAVYELEHYG
VPFSRNEEGKIYQRPFGGHMQNYGAGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFI
EYFALDLIMSDDGRCTGVVAWNLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGDG
GGMIARAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAKD
LASRDVVSRCMTLEIREGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVT
REPIPVLPTVHYNMGGIPTNFWGEVLNADSANPERIAPGLMAVGEAGCASVHGANRLGSN
SLIDLVVFGRAAAIRAGEVIDRAAPVPALNTAACDKIMDRFDRLRNANGGTPTAVLRDKM
QRTMQEDAAVFRTQESLESGCRRMSSIWGELKDVKVTDRSMIWNSDLVETLELENLMANA
ITTVYGAEARKESRGSHAREDFTEGPFGGRDDVNWRKHTLAWVNEAGDVKLDYRPVHTEL
IADGIDPAKIEPKARVY
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgatcactcccattgcgcaggggacatcccagaccggcaaggcctatacctat
gtcgaccactcctatgacgtgattgtcgtgggcgccggcggcgcgggcctcagggcgacg
ctcggcatggccgagcagggctttaagacggcctgcatcaccaaggtcttcccgacgcgt
tcccacaccgtggctgcacagggtggcatcgccgcctcgctgaccaacatgacgccggat
tgctggcagtggcacctctacgataccgtcaagggctccgactggctgggcgatgtcgat
gccatgcaatatctcgccatggaagcgccgaaggctgtttacgagctggaacattacggc
gtgccgttttcccgtaacgaggaaggcaagatctaccagcggccattcggcggtcacatg
cagaactacggcgccggtccgccggtgcagcgcacctgcgctgccgcagaccgtacagga
cacgcgatcctgcacacgctctacggccagtcgctgcgcaacaatgccgaattcttcatc
gagtacttcgcgctcgacctgatcatgtcggacgacggccgctgcacaggggtcgtcgcc
tggaatctggacgacggcacgatccatcgcttcgccgccaagatggtggtgctggcaacc
ggtggttatggccgcgcctacttctcggcgacttccgcgcatacctgcaccggagacggt
ggcggcatgatcgcgcgtgccgggctgccgctgcaggacatggagttcgtccagttccac
ccgacaggcatctacggatccggctgtctgattaccgaaggcgcgcgcggcgagggcggc
tacctcgtcaactccgaaggcgagcgtttcatggagcgctatgcgccctccgccaaggac
ctggcctcgcgcgatgtcgtttcccgctgcatgacgctggagatccgcgaggggcgcggc
gtcggcaagaacaaggaccacatcttcctgcatctcgatcacctggatccggctgttctg
cacgaacgcctgccgggtatctcggagagcgccaagattttcgccggcgtcgacgtcacc
cgcgagccgatccccgtcctgccgaccgtgcactacaacatgggcggcatcccgacgaat
ttctggggtgaggtcctgaacgcggacagcgctaatccggagcggatcgctcctggcctg
atggcggtcggcgaggccggctgcgcgtcggttcatggtgcaaaccgtcttggttcgaac
tcgctgatcgaccttgtcgttttcggccgtgccgccgcaatccgggcaggcgaggtgatc
gaccgggcagcacccgtgccggcgctcaacactgccgcctgcgacaagatcatggaccgc
tttgaccgccttcggaacgccaatggcggaacgccgacagcggtgctgcgcgacaagatg
cagcgaaccatgcaggaagatgctgccgtcttccgcacgcaggagtcgctggaatccggc
tgccgccgcatgtcatcgatctggggagagctgaaggacgtcaaggtcaccgaccgctcg
atgatctggaattccgacctcgtggagacgctggagctggagaacctgatggcgaacgcc
atcaccaccgtctacggcgccgaagcacgcaaggaaagccgtggcagccacgcccgcgag
gactttacggaaggcccgttcggcggtcgcgacgacgtgaactggcgcaagcatacgctt
gcctgggtcaacgaagccggcgacgtgaagctggactatcgcccggttcatacggaactc
attgccgatggcatcgatcctgcgaagatcgagcccaaggcccgcgtctactga

DBGET integrated database retrieval system