KEGG   Rhodococcus sp. PBTS 1: A3Q40_00595Help
Entry
A3Q40_00595       CDS       T05182                                 

Gene name
glpD2
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu00564  Glycerophospholipid metabolism
rhu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A3Q40_00595 (glpD2)
Enzymes [BR:rhu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A3Q40_00595 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C GIDA 3HCDH_N Pyr_redox NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: AMY18003
UniProt: A0A143Q3V0
LinkDB All DBs
Position
638519..640225
Genome map
AA seq 568 aa AA seqDB search
MTTTSTALSPDARREALRRLASEEMDVLVIGGGVVGTGAALDAVTRGLKVGLVEARDYAA
GTSSRSSKLFHGGLRYLEQFNFSLVFEALKERSLVLNDLCPHLARPVPFLYPLLKVIDRP
YAGLGIGVYDVMGAGRGVPSHHRHLGKKKTLEAFPSGKRSALRGAIKFYEGQVDDARHTM
MIARTAAAYGALCVNSTRVTGFLRDGDRVIGVVATDLETGESFEIAAKHVINAAGVWTDE
IQEMLGGRGQFQVRASKGVHLVVPRNRINAAAGIITRTSKSLLFVIPWGSHWIIGTTDTD
WKLDLAHPAASKSDIDYILTEVNRLLQDPLDHEDVVGVYAGLRPLLYGESDSTSTLSREH
AVSSPVRGLTVIAGGKYTTYRVMAKDAVDSAVHGLERRVPECVTEKIPLLGAEGYYGLWN
SRELAAQRAGMRVGRMEHLLGRYGSLVHEVLALIDERPELGQPLETAPAYLKAEAVYAAS
HEGAQHLDDILTRRIRVSIELDDRGEAAASEVAALVAPILGWDEQHVADEIEHYRKRVAA
ERESQMQPDDETADAARLGAPDVRVPVA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaccagcacagcactgagtcccgacgcgcgtcgtgaggcgttgcgccgcctc
gcctccgaagagatggacgtcctggtcatcggcggcggtgtcgtcggtaccggggcggcg
ctcgacgccgtcacccgcggcctgaaggtcggtctcgtcgaggcgcgggactacgccgcg
ggcacgtcgagccgatcgtccaagctcttccacggcggcctgcgctacctcgagcagttc
aacttctcgttggtgttcgaggccctcaaggagcggtccctcgttctcaacgacctgtgc
ccgcacctcgcgcgcccggtcccgttcctctacccgctgctcaaggtgatcgaccggccg
tacgcggggctcggcatcggggtgtacgacgtcatgggcgccggtcgcggcgtgccgtcg
caccatcgccatctgggcaagaagaagacgctcgaggccttcccctccggcaagcgctcc
gcgcttcgcggcgccatcaagttctacgagggccaggtcgacgacgcccggcacaccatg
atgatcgcgcggaccgccgcggcgtacggggcgttgtgcgtcaacagcactcgcgtcacc
ggattcctgcgcgacggtgaccgggtgatcggcgtcgtcgcgacggacctcgagacgggg
gagtcgttcgagatcgcggccaagcatgtcatcaacgcggccggcgtctggaccgacgag
atccaggagatgctcggtggccgtgggcaattccaggtgcgcgcctccaagggtgtccac
ctggtcgtgccgcgcaaccggatcaacgcggcggcgggcatcatcacccggacgtcgaag
tcgctgctgttcgtgattccgtgggggagccactggatcatcggcaccaccgacaccgac
tggaagctcgatctcgcgcatcccgcggcgagcaagagcgacatcgactacatcctcacc
gaggtcaaccggctcctgcaggatccgctggaccacgaggacgtcgtcggcgtctacgcc
ggactgcgcccgttgctctacggcgagtcggattccaccagcaccctctcgcgcgagcac
gcggtgtccagcccggtccgcggcctcacggtcatcgcgggcggcaagtacaccacctac
cgcgtgatggccaaggacgccgtggattccgcggtgcacggtctcgagcgccgggttccc
gagtgcgtcaccgagaagatcccgctgctcggcgcggaggggtactacggcctgtggaac
tcccgcgagctcgctgcgcagcgcgccgggatgcgggtggggcggatggagcacctgctc
gggcgctacggatccctggtccacgaggtgctcgcgttgatcgacgagcggcccgagctc
gggcagcccctggagacggcgccggcgtacctcaaggccgaggcggtctacgccgccagc
cacgagggcgcgcagcatctcgacgacatcctcacccgtcgtattcgcgtgtccatcgag
ctcgacgaccgcggtgaggccgcggcctccgaggtcgccgcgctggtcgcccccatcctc
ggctgggacgagcagcacgtggccgacgagatcgagcactaccgcaagcgcgttgccgcg
gaacgggaatcgcagatgcagccggacgacgagaccgcggacgccgcgcggctcggggcg
ccggacgtgcgagtgcccgtggcttga

DBGET integrated database retrieval system