KEGG   Rhodococcus sp. PBTS 1: A3Q40_01297Help
Entry
A3Q40_01297       CDS       T05182                                 

Gene name
pfp
Definition
(GenBank) Pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu00010  Glycolysis / Gluconeogenesis
rhu00030  Pentose phosphate pathway
rhu00051  Fructose and mannose metabolism
rhu00052  Galactose metabolism
rhu00680  Methane metabolism
rhu01100  Metabolic pathways
rhu01110  Biosynthesis of secondary metabolites
rhu01120  Microbial metabolism in diverse environments
rhu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3Q40_01297 (pfp)
   00030 Pentose phosphate pathway
    A3Q40_01297 (pfp)
   00051 Fructose and mannose metabolism
    A3Q40_01297 (pfp)
   00052 Galactose metabolism
    A3Q40_01297 (pfp)
  Energy metabolism
   00680 Methane metabolism
    A3Q40_01297 (pfp)
Enzymes [BR:rhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A3Q40_01297 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     A3Q40_01297 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AMY18689
UniProt: A0A143Q6X1
LinkDB All DBs
Position
1408517..1409548
Genome map
AA seq 343 aa AA seqDB search
MTRIGILTSGGDCPGLNAVIRGAVLKGSAVHGQEFVGFLGGWRGLVHGESIPLDRSVVRG
LSHQGGTILGTSRFGPYQEPHGGAENIQRTLDRLGVDGVIAIGGEGTASASKRLFEDGID
IVGVPKTIDNDLDATDYTFGFDTAVEIATEAIDRLRTTGNSHDRCMVLEVMGRHAGWIAL
HSGIAGGAHAILIPEQPESLEQICAWATSVRDRGRAPMIVVAEGFTLPDMTEAHSTKGLD
GFDRPRLGGIGEWLAPLIEERTGIETRATVLGHIQRGGVPTAFDRVLATRLGMAIVDLVA
DGGWGQMVALHGTDIARVGFDEALANHKTVPAGRYQEMRVLFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggatcggcattctgaccagtggcggggactgcccgggcctgaacgcggtcatc
cgcggcgccgtgctcaagggctccgcggtgcacgggcaggagttcgtcggattcctcggc
ggatggcggggactggtgcacggggagtcgattcccctggaccgcagcgtcgttcgtggt
ctctcccaccagggcggcaccatcctcggcaccagccggttcggtccgtaccaggagccg
cacgggggtgcggagaacattcaacgcacgctcgaccggctgggggtcgacggcgtcatc
gccatcggcggcgagggcacggccagtgcgtcgaagcggttgttcgaggacggaatcgat
atcgtcggggtccccaagaccatcgacaacgacctcgacgccaccgactacacgttcggg
ttcgacacggcggtcgagatcgccaccgaggccatcgaccggctgcggaccaccggcaat
tcgcacgatcgctgcatggtgctcgaggtcatgggtcggcacgccgggtggatcgccctg
cactccggcatcgccggcggggcccacgccattctcattcccgagcagccggagagtctc
gagcagatctgtgcgtgggcgaccagcgtgcgcgaccgcggccgcgctcccatgatcgtg
gtcgccgagggcttcaccctgccggacatgacggaggcgcactcgacgaaggggctcgac
ggtttcgatcgcccccggctcggcggaatcggtgagtggctcgcgccgttgatcgaggag
cgcaccggaatcgagacgcgcgcaacggttctcggccacatccagcgcggcggagtgccg
acggcgttcgaccgagtgctcgcgacccgactcggcatggccatcgtcgacctcgtcgcc
gacgggggatgggggcagatggtggcccttcacggcaccgacatcgcccgcgtcggattc
gacgaggctctcgcgaaccacaagacggttccggcggggcgctaccaggaaatgcgcgtc
ctcttcggctag

DBGET integrated database retrieval system