KEGG   Rhodococcus sp. PBTS 1: A3Q40_03548Help
Entry
A3Q40_03548       CDS       T05182                                 

Gene name
dnaX_2
Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu03030  DNA replication
rhu03430  Mismatch repair
rhu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rhu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    A3Q40_03548 (dnaX_2)
   03430 Mismatch repair
    A3Q40_03548 (dnaX_2)
   03440 Homologous recombination
    A3Q40_03548 (dnaX_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rhu03032]
    A3Q40_03548 (dnaX_2)
   03400 DNA repair and recombination proteins [BR:rhu03400]
    A3Q40_03548 (dnaX_2)
Enzymes [BR:rhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A3Q40_03548 (dnaX_2)
DNA replication proteins [BR:rhu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     A3Q40_03548 (dnaX_2)
DNA repair and recombination proteins [BR:rhu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     A3Q40_03548 (dnaX_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA RuvB_N AAA_22 AAA_16 AAA_30 Mg_chelatase AAA_19 Rad17 AAA_14 Sugarporin_N Herpes_Helicase
Motif
Other DBs
NCBI-ProteinID: AMY20907
UniProt: A0A143QEQ7
LinkDB All DBs
Position
complement(3781106..3783367)
Genome map
AA seq 753 aa AA seqDB search
MALYRKYRPASFAEVVGQEHVTEPLSVALDSGRINHAYLFSGPRGCGKTSSARILARSLN
CVQGPTSTPCGVCPSCVALAPGGPGNLDVIELDAASHGGVDDTRELRDRAFYAPAESRYR
VFIVDEAHMVTTAGFNALLKIVEEPPEHLIFVFATTEPEKVLPTIRSRTHHYPFRLLPPV
AMRGLMERICAEENVTVQDAVYPLVIRAGGGSPRDTLSVLDQLLAGAGDEGVQYSRALML
LGVTDVALIDEAVDALAAQDGAALFGTVEKVMDAGHDPRRFAVDLLDRFRDLILMRAVPD
AGERGLVDAPADMIERMRDEAERIGPATLARYAETVHAGLGEMRGATAPRLLLEVMCARM
LLPAASDAESAVLQRIERLERRLDVSLPAGEQAAVDAEHRQGRVAAERSETPRADTPRVA
APADTQAAPRFVRPSERAAAAPPAPEPARPEPQRPEPPRQERPVEQPPAPASPAPAPPRQ
EHPAPEPPRREQPTPQPAAPEPAAPEPAAQEPPRPEPTPEPTPEPQPHAAPEYAPEPTPE
PQPEPEPVAATGPDAADIRAVWSEVRSKVRERSRTVEVMLSGATVRAVTDGTLVLAHDSA
PLAKRLVEPRNAAVIVDALRDVFGVEWTVQCEVGGAAAAPTPSAAPAAAPKERPAPPRFS
RPSRSTPPPTQSNGSPDGRDGSDDIPPPPEEPDYPDPGYDSYDGPPPPESPEEQEEMMEQ
AKEPVDPATRRDPDEVALELLQTELGATPIKEV
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
gtggccttgtaccggaagtaccgtccagcgtcgttcgcggaagtggtgggccaggagcac
gtcaccgagccgctgtccgtcgccctggattccggccgcatcaatcacgcctacctgttc
tccggcccgcgcgggtgcggcaagacgtcgtcggcgcgcatcctggctcgctcgctcaac
tgcgtccagggcccgacgtcgacgccgtgtggtgtctgcccttcgtgcgtggccctggcg
cccggtggtcccggcaacctcgatgtgatcgagctcgacgccgccagccacggcggtgtc
gacgacacacgagagcttcgggatcgggcgttctacgccccggccgagtcgcgctaccgc
gtgttcatcgtggacgaggcgcacatggtcaccacggccggattcaacgcgctgctcaag
atcgtcgaggagccgccggagcatctgatcttcgtgttcgccaccacggagccggagaag
gtgctgccgaccattcgcagccggacgcaccactacccgttccggttgctcccgcccgtc
gcgatgcgcgggttgatggaacgtatctgcgccgaagagaacgtgacggtgcaggatgcc
gtgtatccgttggtgattcgggccggtggggggtcgccgcgtgacacgctcagtgttctc
gaccagctgctcgccggtgcgggagacgagggtgtccagtactcgcgcgcgcttatgttg
ctcggggtcaccgatgtcgcgctgatcgacgaagcggtcgacgccctggccgcgcaggac
ggtgctgcgctgttcggaacggtggagaaggtcatggacgcggggcacgatccgcgccgc
ttcgcagtcgacctcctcgaccgcttccgggatctgatcctcatgcgcgcggtgcccgac
gccggggagcgcggtctcgtcgacgcccccgccgacatgatcgagcggatgcgggacgag
gccgagcgcatcgggccggccaccctggcgcgctacgccgagacggtgcacgccgggctg
ggcgagatgcgtggtgccacggcgccgaggttgctgctcgaggtcatgtgcgcacgcatg
ctgctgccggcggcgtcggacgcggaaagcgctgtgctgcaacgcatcgaacgcttggaa
cgacgtctcgacgtcagtcttccggccggtgagcaggctgcggtggacgccgagcaccgg
cagggtcgcgtcgccgccgagcggtccgagaccccgcgcgccgacaccccgcgcgttgcc
gcccccgcggacacgcaggccgcaccgcggttcgtccgaccgtccgagcgcgccgccgcc
gcaccacccgccccggaaccggcgcgcccggagccgcagcgccccgagccgccgcgccag
gaacgtccggtcgagcagccgcctgccccggcatcccccgccccggcacccccgcgccag
gaacaccctgccccggaacctccgcgccgggagcagcccactccgcagcccgcggcgccg
gaaccagcggcgcccgaacccgcagcgcaggaaccgccgcgcccggaaccgaccccggaa
cccacccccgagccgcaacctcatgccgcccccgagtacgcacccgagcccaccccggaa
ccccagccggaaccggaacccgttgcggcgaccggcccggacgccgccgacatccgcgcg
gtgtggtcggaggtccgcagcaaggtgcgggagcgaagccggacggtcgaggtgatgctg
tccggcgccaccgtccgggcggtcaccgacggcaccctcgtgctcgcccacgactccgcc
ccgctggcgaagcggttggtcgagccgaggaacgccgcggtcatcgtcgacgcgttgcgt
gacgtgttcggggtcgagtggacggtgcagtgcgaggtgggcggtgctgctgccgccccc
acgccctccgcggcacccgcagcggcgccgaaggagcgtccggcgccgcctcggttctcg
cgcccgtcccggtcgacgccgccgcccacgcagtcgaacggatccccggacggccgcgac
gggtcggacgacatcccgccgccccccgaggagccggactatccggatccggggtacgac
tcctacgacggccctccgcctccggaaagtccggaggagcaggaggagatgatggagcag
gcgaaggagccggtcgatcccgcgacgcgtcgcgatcccgacgaggtggccctcgaactg
ctgcagaccgagctcggcgcgacgccgatcaaggaggtctag

DBGET integrated database retrieval system