KEGG   Rhodococcus sp. PBTS 1: A3Q40_03914Help
Entry
A3Q40_03914       CDS       T05182                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rhu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    A3Q40_03914
Enzymes [BR:rhu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A3Q40_03914
DNA repair and recombination proteins [BR:rhu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A3Q40_03914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AMY21262
UniProt: A0A143QFK0
LinkDB All DBs
Position
complement(4177356..4179653)
Genome map
AA seq 765 aa AA seqDB search
MPPAGSTRREIDGHTLAFTNPDKVLYPETGTTKAEVIDYYLAVADAMLPHLAGRPVTRKR
WPNGVDHPAFFEKNLAASAPDWLDRRRIHHSDRVVVYPVFHGPADLAWLGQQAALEAHVP
QWTFDRDEQGKATRIVFDLDPGDDVDLDTCATVACAVRTMVTDIGLTAFPLTSGSKGIHL
YVPLEKPVTSAGASTVAKRVATLLEGTMPDLVTASMSKALRPGKVFLDWSQNNGKKTTIA
PYSLRGRSRPTVAAPRTWEEIEGGGLTQLAFTEVIDRLHRDGDLLADLDAAVPGGTADRL
GPYRGKRTTSRTPEPVPTGTTPESRSAATTFVIQEHHARRLHYDFRLERDGVLVSWAVPK
NLPTDTTSNHLAVHTEDHPLDYATFEGTIPAGEYGGGEVTVWDHGTYIEEKWRDDEVIVT
LTGERVSGRYALIRTGGDQWLVRRTKTTASGVPQGDTALPTRVRPMLATAGELDALDADQ
WSFEGKWDGVRVVATVDHGRTLLESRTGQDLTRRYAGITALGADLADHVVVLDGEAVVYR
ADGVTSFEALQDAHPDDVQYICFDILHLDGTDLTNKKFADRRRILELLLTGIESATLSPL
MAGTPAGALAESERRGWEGIVAKRRDSVYEVGRRSTAWIKVKNWRTQEVVIGGWRAGKGG
RAGSIGSLLLGVPEGDGLRYVGRVGTGFTERARADLLDRLRPLARDDSPFDRPLPAVDRK
DATWTEPALVGEVRFFEWTEGGSLRHPSWRGLRDDKSPADVVREP
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgccgggtcgacgcgtcgcgagatcgatgggcacacgctggccttcaccaat
ccggacaaggtcctgtatccggagaccggcaccaccaaggccgaggtgatcgactactac
ctcgccgtggccgacgccatgctgccgcatctggccggtcggccggtcacccgcaagcgg
tggccgaacggcgtcgaccacccggcgttcttcgagaagaacctcgccgcatcggctccg
gactggttggaccgccgccgcattcaccattcggaccgcgtcgtggtgtacccggtgttc
cacggccccgccgacctcgcgtggctcgggcagcaggcggccctcgaggcgcacgtcccc
cagtggaccttcgatcgcgacgagcagggcaaggccacccgcatcgtcttcgacctcgat
cccggcgacgacgtcgacctcgacacgtgcgcgacggtcgcgtgcgcggtgcggaccatg
gtcaccgacatcggactgaccgcgttcccactcacgagcggcagcaagggaattcacctc
tacgtgccgctggagaagccggtcacctcggccggggcgtccaccgtggccaagcgggtg
gccaccctgctcgagggcacgatgcccgacctcgtgacggcgtcgatgtccaaggcgctg
cgtcccggcaaggtgttcctcgactggagccagaacaacggcaagaagaccaccatcgcg
ccctactcgctgcgcggccgcagccgacccaccgtggccgccccgcggacctgggaagag
atagagggcggcgggctgacccaactcgcgttcaccgaggtgatcgaccgcctgcaccgc
gacggggacctgctggccgatctggacgccgccgtccccgggggcaccgccgaccggttg
ggaccgtatcgcggcaagcgcaccacgtcgcgcacgcccgagcccgtcccgaccgggacg
acaccggaatctcgttccgccgcaaccacgttcgtcatccaggaacatcacgcgcgccgg
ttgcactacgacttccgactcgaacgcgacggcgttctcgtctcgtgggccgtgccgaag
aacctgcccaccgacaccacgtcgaaccacctcgccgtccacaccgaggaccaccccctc
gactacgccacgttcgagggcacgattccggcgggcgagtacggcggcggcgaggtcacc
gtctgggatcacggcacctacatcgaggagaagtggcgggacgacgaggtcatcgtgacc
ctgaccggcgaacgcgtctccggccgctacgccctgatccggaccggcggcgatcagtgg
ctggtgcggcggaccaagaccaccgcctccggcgtcccgcagggtgacacggccctgccc
acgcgcgtgcgtccgatgctcgcgaccgccggcgagctggacgcgctcgacgccgaccag
tggtcgttcgagggcaagtgggacggcgtgcgcgtcgtcgccaccgtcgaccacgggcgc
acgttgctcgagagtcgcacgggacaggacctcacccgtcgctacgcggggatcacggcg
ctgggggccgacctggccgaccacgtcgtggtcctcgacggcgaggccgtggtgtaccgc
gccgacggcgtcaccagcttcgaggcgctccaggacgcccaccccgacgacgtgcagtac
atctgcttcgacatcctccatctcgacggtaccgacctgacgaacaagaagttcgccgac
cgtcgtcgcatcctcgagctgcttctcaccggaatcgagtcggccaccctctctcccctg
atggccggtaccccggccggcgcgctggccgagagcgaacgacgcgggtgggagggcatc
gtcgccaagcgccgcgattccgtctacgaggtcggccgtcgcagcaccgcgtggatcaag
gtgaagaactggcgcacgcaggaggtggtgatcggcggctggcgcgccgggaagggcggg
cgggccggcagcatcggttccctgctgctcggtgtgcccgagggcgacgggctgcgatac
gtgggtcgggtcggcaccgggttcaccgagcgcgcccgcgcggacctgctcgatcggctg
cggccgctggcgcgggacgactctccgttcgaccgtccgttgccggccgtggatcgcaag
gatgcgacgtggaccgaacccgcgctggtcggcgaggtgcggttcttcgagtggaccgag
ggcggatcactgcgtcatcccagttggcgcgggctgcgcgacgacaagagtcccgcggac
gtggtgcgggagccctga

DBGET integrated database retrieval system