KEGG   Rhizobium sp. S41: BA939_04045Help
Entry
BA939_04045       CDS       T05451                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rhv  Rhizobium sp. S41
Pathway
rhv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rhv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BA939_04045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhv02000]
    BA939_04045
Enzymes [BR:rhv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BA939_04045
Transporters [BR:rhv02000]
 Other Transporters
  Pores ion channels [TC:1]
   BA939_04045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANV23181
LinkDB All DBs
Position
1:812443..813069
Genome map
AA seq 208 aa AA seqDB search
MSELIFYTNPMSRGRIARWMLEEVGVPYRTEILRFETSMKSPAYRLINPMAKVPAIKHGD
TIVTEAAAICAYLADAFPGANLAPTPKSRGLYYRWMFFAAGPLEMAASMKAMGFEVPKEK
LRMAGCGSYADVMNTLERAVSENRFIAGDLFTAADVYVGAHVGWGLQFGTIEKRPAFIDY
LSHLTERPAFKRAAQLDEEAVKDMKATD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgatcttttacaccaaccccatgtcgcgcgggcgcatcgcgcggtggatg
ctcgaggaagtgggcgttccctatcgaaccgagatacttcgtttcgaaacctcgatgaaa
tcgcccgcctatcggctgatcaatccgatggccaaggtgcccgccatcaaacatggcgat
accatcgtcaccgaggccgccgcgatctgcgcctatctggctgacgcctttcccggtgcg
aacctagcgcccacacccaagtcacgcgggctttattaccgctggatgttctttgccgca
ggcccgctggaaatggcggcgagcatgaaggcaatgggttttgaagtgccgaaggaaaaa
ttgcgtatggccggctgcggcagctatgcggatgtgatgaacacgctggaacgggccgtc
agcgaaaaccgcttcatcgccggcgatctttttaccgccgcggatgtctatgtcggcgcc
catgtcggctggggcctgcaattcggcacgattgaaaaacgcccggccttcatcgactac
ttgtcgcatctgaccgagcgcccggcatttaagcgggccgcgcagctcgatgaggaagcg
gtgaaggatatgaaagcgacggactag

DBGET integrated database retrieval system