KEGG   Rhizobium sp. S41: BA939_05835Help
Entry
BA939_05835       CDS       T05451                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rhv  Rhizobium sp. S41
Pathway
rhv00240  Pyrimidine metabolism
rhv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BA939_05835
Enzymes [BR:rhv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BA939_05835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: ANV25144
LinkDB All DBs
Position
1:1182470..1183051
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTLIFTAAFDDRAGVGRVASRIGLSSDAL
TFDENTDLFAEVSALHVQAPVACVFVDEANFLSEHHVWQLAEIVDRLDIPVMTYGLRTDF
QGKLFPASKELLAIADELREIRTICHCGRKATMVARFDNEGNVVTEGAQIEVGGNEKYVS
FCRRHWVETFNGG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaattattcgacgatgaatgccggcaaatcgaccatgctgctt
caggcgtcctataattatcaggagcgcggcatgcgcacgctgatcttcacggccgcgttt
gacgaccgcgccggcgtcggccgtgtcgcctcgcgcattggtctgtcctccgacgccctg
accttcgatgaaaataccgatttgttcgctgaagtatcggccttgcatgtacaggcgccc
gtcgcctgcgttttcgtcgacgaggccaatttcctctcagaacaccatgtctggcagctt
gccgagattgtcgaccggctggacatcccggtcatgacctatggtctgcgcacggatttc
cagggcaagctcttccctgcctcgaaagaactgcttgcgattgccgacgagcttcgcgaa
atccgcaccatctgccattgcggccgcaaggcgacgatggtggcccgcttcgacaatgaa
ggaaatgtcgtcacggaaggcgcgcagattgaggtaggcggcaacgaaaaatatgtttcc
ttctgccgccgccactgggtggagacgttcaacggcggctga

DBGET integrated database retrieval system