KEGG   Rhizobium sp. S41: BA939_21655Help
Entry
BA939_21655       CDS       T05451                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rhv  Rhizobium sp. S41
Pathway
rhv00564  Glycerophospholipid metabolism
rhv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BA939_21655
Enzymes [BR:rhv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BA939_21655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 STPPase_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ANV26529
LinkDB All DBs
Position
2:complement(1507863..1509386)
Genome map
AA seq 507 aa AA seqDB search
MSDEAIHDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSAATKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHIIWPMRFVLPFQKGGVRPAWLVRLGLFLYDHLGGRKL
LPATRSLDLRRDPAGKPLKPIFARAFEYSDGWVDDARLVVLNARDAADRGALILNRTQVV
SARRDGAFWRVETRNAAGETQVHRARMLVNAAGPWVDRVLSATFGKNNVHNVRLVQGSHI
IVRKKFSDPRAYFFQNPDGRIIFAIPYEQDFTLIGTTDRDYTGDPRAVKISDEEISYLCS
AASEYFAEPVKPADIVWTYSGVRPLFDDGASKAQEATRDYVLKTEGADGEAPLLNIFGGK
LTTYRRLAEHALEKIGDALGTKGAPWTAGSHLPGGNFNVEAYAAEVSALLSRYPFLEKRH
AERLVRCYGTDVAAMIGNATDASALGRHFGGTLYEAEVRWLMAREWALTAEDILWRRTKQ
GLFLTSDEVRGLEDYIDDIAGGRLKAI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgaggcaattcacgatattttcgtgatcggcggcggtatcaatggctgcggc
attgcgcgcgacgccgtcggcaggggctattccgtcgcactcgccgaaatgaacgatttc
gcctccggtacgtcgtctgctgcaaccaagctcattcatggcggcctgcgttatctcgaa
cattacgagtttcgcctggtgcgcgaagcactgatggaacgcgaggttctgtgggccatg
gcgcctcatatcatctggcccatgcgtttcgtgctgcccttccagaagggcggtgtgcgt
ccggcgtggctcgtgcgtctcgggctcttcctttacgatcatcttggcggccgcaagctt
ctgcccgccacccgctcgctcgatctgcgccgtgatccggccggaaagcctttgaaaccg
attttcgcccgggctttcgaatattccgacggatgggtcgatgacgcccgcctggtcgtg
ctgaacgcccgtgatgccgctgaccgtggcgcgttgatcctcaatcggacgcaggtggtt
tccgcgcggcgcgacggcgcgttctggcgggtcgagacgagaaatgccgccggagaaacg
caggtccaccgggcgcggatgttggtgaatgccgccggtccatgggtcgacagggttctg
tcggcgaccttcggaaaaaacaacgttcacaatgttcgcctcgtccagggcagccatatc
atcgtgcgcaagaagttctccgatccgcgcgcctacttctttcagaatccggatggccgc
atcattttcgccatcccttacgaacaggatttcaccctgatcggcacgacggatcgcgac
tataccggtgacccccgggctgttaagatcagcgacgaggaaatcagctatctctgcagc
gcggcgagtgaatattttgccgaaccggtgaagccggccgatattgtctggacctattcc
ggagtgcggccgctttttgatgacggtgcgtcaaaagcgcaggaggcgacgcgtgattat
gtcttgaagaccgagggggccgacggcgaggcaccacttctcaatattttcggcggcaag
ctcaccacttatcggcgacttgccgaacatgctcttgaaaagatcggcgatgcgctggga
acaaagggagccccatggacagcgggttctcatctgccgggcggaaatttcaatgtagaa
gcttatgctgcggaggtttctgcgctgctatcgcgttatcccttcctggaaaagcgtcat
gcggagcggcttgtccgctgctacggcaccgatgtggcggcgatgataggcaatgcgaca
gacgcgtcggcgcttgggcggcatttcggcggcacgctctacgaagccgaagttcgctgg
ctgatggcgcgggaatgggcgctgacggcggaggatattctgtggcgccgtaccaagcag
gggctttttttgacatccgacgaggtgcgcgggttggaggactacatcgatgacattgca
ggtggacgattgaaggcaatctga

DBGET integrated database retrieval system