KEGG   Rhodococcus sp. WMMA185: BFN03_00555Help
Entry
BFN03_00555       CDS       T04814                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
rhw  Rhodococcus sp. WMMA185
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AOW94212
UniProt: A0A1D8T990
LinkDB All DBs
Position
155946..156974
Genome map
AA seq 342 aa AA seqDB search
MPPLQPMLAKAASRVPPQPESGAAWLYEPKWDGFRTIVFRDEDEVVLGSRGGKDLARYFP
ELVRAVRDELPPRCVVDGELVVPRKLDGRTRLDWESLSERIHPAESRVTMLSEKTPAQFV
AFDLLALGDRDSSREDFAIRRALLVENIGGGPSCHVTAATKSSATATEWFEMFEGAGLDG
VVAKKLVGRYLPNKREMVKVKHSRTADCVVIGYRPHKSQAGIGSMLLGLYDGDQMAMVGG
VSAFTSPRRVELLAELEELRIGEDVVAEGEPTRWRSGNDRHWVPLRPERVVEVAYDQMEG
SRFRHAARFLRWRPDRTPDECTFGQLEVPVRYDLDDVLTGGS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccgccattgcagcccatgctggccaaggcggcgtcgcgcgttccgccgcaaccggag
tccggggctgcgtggttgtacgagccgaaatgggacggattccggaccatcgtcttccgc
gacgaagacgaggtggtccttggttcgaggggtggaaaggatctggcccggtactttcct
gaactcgtgcgcgctgtacgagacgaactgccgccgcggtgcgtggtggatggcgaactc
gtcgtaccgcgaaagctcgacgggcgtacccggctggactgggaatcgctgtccgaacgc
attcatccggcggagagtcgggtgacgatgctgtcggagaagactccggcccaattcgtc
gccttcgatctgcttgctctgggtgatcgggactcgagcagggaggacttcgcgattcgg
cgcgcgctgttggtcgagaacatcggtggcggaccaagctgtcacgtgaccgcagccacc
aaatccagcgcgaccgcgaccgagtggttcgagatgttcgagggggccgggctcgacggc
gtggtagcgaagaagctcgtcggacggtacctaccgaacaagcgggaaatggtgaaggtg
aagcattcccgcaccgcagactgtgtcgtgatcggataccggccgcacaagagtcaagcg
ggtatcgggtccatgctgctcgggctgtacgacggtgaccagatggcgatggtcgggggt
gtatcggctttcacctcgccccggcgcgtcgaactgcttgcggaactggaggaactgcgc
atcggtgaggacgtcgtcgccgagggtgagcccacccgctggcggtccggcaacgaccgg
cactgggtgccgctgcggcccgaacgcgtggtcgaggtggcgtacgaccagatggagggt
tcgcgtttcaggcacgccgcgcggttcctgcgctggcggccggaccggacccccgacgaa
tgcacgttcgggcaactggaggttccagtgcgatacgacctcgacgacgtgctgacggga
ggctcgtag

DBGET integrated database retrieval system