KEGG   Rhodococcus sp. WMMA185: BFN03_00735Help
Entry
BFN03_00735       CDS       T04814                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rhw  Rhodococcus sp. WMMA185
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOW91705
UniProt: A0A1D8T2J8
LinkDB All DBs
Position
complement(194834..196282)
Genome map
AA seq 482 aa AA seqDB search
MTDYDKLYIGGKWVAPATDQVLEVFSPATEERVGSCPVASPADIDDAVVAARQAFTQGPW
PNTTPAERGEILAKAAKLIEERGETLASLISSEMGQPPAMVSMMQQTPSLATLNFYAGLA
NDFEWEQTRTGVFGQSRVLREPVGVVAAVLAWNVPLFLAVNKLAPALLAGCTVLLKPAPE
SPLATHLVAEIFAEAGVPEGVISVLPGGAETGEYLVSHPGIDKVTFTGSSPVGRRIGAIA
AQNLKSCSLELGGKSAAIILEDADLDATMPMLVMSGLMNTGQACVAQTRILAPRSRYNEV
LDKLVAGAGLMTVGDPSDPAAQLGPLISEKQRNRVEDYIAKGKEQGARLVLGGGRPAGFD
KGWYVEPTIFADVDNSMTIAREEIFGPVLAVIPYDSEEEAIKIANDSEYGLAGSVFTTDI
EHGFAVAKKIRTGSYAINWYAFDPGSPFGGYKASGIGRENGPEGLESFCETKSVLMPLGY
TG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgactgactacgacaagctctacatcggcggcaagtgggttgcgcccgcaaccgatcaa
gtgctcgaagtgttctcccccgcaaccgaagaacgcgtcggtagctgcccggtcgcgtcg
ccggccgacatcgatgacgccgtcgtcgctgcccggcaagcgtttacgcaggggccctgg
ccgaacaccactcctgcggagcggggcgagatccttgccaaggcggccaagctgatcgaa
gagcgcggcgaaactctcgcctcactcatctcgtccgagatgggccagccgccggcgatg
gtctccatgatgcagcagacaccctcactggcgaccctgaacttctatgccggcttggcg
aacgatttcgagtgggagcagacccgcaccggcgtcttcggccagagtcgggtgttgcgc
gagcccgtcggcgtggtggcggctgtcctcgcctggaacgtgccgctgttcctggctgtc
aacaagctggccccggcgttgctggctgggtgcaccgttctattgaagccggctcccgaa
tctcctctcgccacccatcttgtcgccgagatctttgccgaggcgggtgtcccggaggga
gtcatctccgtccttcccggtggcgccgagacgggcgaatacctcgtctcccatcccggc
atcgacaaggtgacgttcaccggaagcagtccggtgggccgccgaatcggagcgatcgcg
gcacagaacctcaagagttgctcactcgaactgggcgggaagtcggcggcgatcatcctc
gaggacgccgacctcgatgccacgatgccgatgctggtgatgtccgggctcatgaacacc
ggccaggcgtgcgtggcgcaaacacgcatcctcgccccccgctcgcggtacaacgaggtg
ctggacaaactggtggcgggtgccggactcatgacggtcggggatccctccgacccggct
gcccaactcgggccgctgatctccgagaagcagcgcaatcgcgtcgaagactacatcgcg
aagggcaaggagcagggcgcacgtctcgtcctcggcggcggaaggcccgcggggttcgac
aagggatggtacgtcgagcccacgatcttcgccgacgtcgacaattcgatgacaatagcc
cgtgaggagatcttcgggcccgtcctggccgtgatcccatacgattccgaggaggaggcg
atcaagatcgccaacgactccgaatatggcctggccggatccgtgttcaccaccgacata
gagcacggtttcgccgtcgcgaagaagatccgcacgggcagctacgcgatcaactggtac
gcgttcgaccctggctcgcccttcggtggctacaaggcctcgggtatcggccgcgagaac
ggtccggaagggctggaatccttctgcgagaccaagtccgtcctgatgccgctcggctac
accggctag

DBGET integrated database retrieval system