Rhodococcus sp. WMMA185: BFN03_01465 Help Entry BFN03_01465       CDS       T04814                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism rhw  Rhodococcus sp. WMMA185 Pathway rhw00400   Phenylalanine, tyrosine and tryptophan biosynthesis rhw01100   Metabolic pathways rhw01110   Biosynthesis of secondary metabolites rhw01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:rhw00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     BFN03_01465 Enzymes [BR:rhw01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      BFN03_01465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 DUF5631 Motif Other DBs NCBI-ProteinID:  AOW91808 UniProt:  A0A1D8T291 LinkDB All DBs Position complement(360984..361280) Genome browser AA seq 98 aa AA seqDB search MSAQTVASADNEPAVPTSEAEIEVLRQEIDKLDAEILAAIKRRAEVSQLIGRTRMASGGP RLVHSREMKVLERFNELGQEGHTLAMLLLRLGRGRLGH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagcgctcagaccgtggcatccgcagacaacgaaccagctgttcccaccagcgaagcc gaaatcgaggtacttcgccaagagatcgacaagctcgacgccgagatactcgccgcaatc aagcggcgcgccgaggtctcgcagctcatcggtcgtacccgtatggcgtccggcggcccc cgcctggttcacagccgtgagatgaaggtgctcgagcgtttcaacgaactcggccaggag gggcacacgctggccatgctgttactgcgcctagggcgcgggcgcctcggacactga

DBGET integrated database retrieval system