KEGG   Rhodococcus sp. WMMA185: BFN03_03995Help
Entry
BFN03_03995       CDS       T04814                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rhw  Rhodococcus sp. WMMA185
Pathway
rhw00020  Citrate cycle (TCA cycle)
rhw00480  Glutathione metabolism
rhw01100  Metabolic pathways
rhw01110  Biosynthesis of secondary metabolites
rhw01120  Microbial metabolism in diverse environments
rhw01130  Biosynthesis of antibiotics
rhw01200  Carbon metabolism
rhw01210  2-Oxocarboxylic acid metabolism
rhw01230  Biosynthesis of amino acids
Module
rhw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rhw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BFN03_03995
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BFN03_03995
Enzymes [BR:rhw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BFN03_03995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOW92150
UniProt: A0A1D8T3A1
LinkDB All DBs
Position
909399..910622
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGVEYRDQTDDQVTVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVPGPGKVMITYTPEDGSEPIEHELVNFPEKGGVVQ
GMYNFTKSIEDFARASLNYGLQQNYPVYLSTKNTILKAYDGAFKDIFQRIYETEFKPEFD
AAGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
KTCEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIGFAQKLE
DVVIKTVEGGQMTKDLAMLVGGDQGYLTTEEFLAALDINLQKAIAEQ
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaggttgagggtaccgtcgtcgaactcgacggcgacgagatgacgcgc
atcatctggcagttcatcaaggacaaattgattcacccgtacttggacgtaaatctcgag
tactacgacctcggggtcgagtaccgggaccagaccgacgaccaggtgaccgtcgatgcc
gccaatgccatcaagaagcacggcgtcggtgtgaagtgcgcgaccatcactccggacgag
gcacgcgtcgaggaattcggcctcaagaagatgtggcggtctcccaacggcaccatccgt
aacattctcggtggcacgatcttccgtgcaccgatcatcatctccaacgttccgcgactg
gttccggggtggaccaagccgatcatcatcggccgccatgccttcggtgaccagtaccgc
gccaccgacttcaaggttcccggccccggcaaggtgatgatcacctacacacccgaggac
ggcagcgagccgatcgagcacgaactggtgaacttccccgagaagggtggagtcgttcag
ggcatgtacaacttcacgaagtccatcgaggacttcgcccgtgcgtctctcaactacggc
ttgcagcagaactacccggtctacctgtcgacgaagaacaccatcctcaaggcgtatgac
ggtgccttcaaggacatcttccagcggatctacgagaccgagttcaaaccggagttcgat
gcggccggcctcacctacgagcaccgcctcatcgatgacatggttgcggcggcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtgcagtccgacacc
gtggcacagggcttcggctcgctcggtttgatgacctccgtactgctgaccccggacgga
aagacctgtgaggccgaggctgctcacgggaccgtgacccgccactaccgtcagcaccag
cagggcaagccgacgtccacgaaccccatcgcatcgatcttcgcgtggacgcggggcctc
gagcaccgcggcaagctggacaacacacccgaggtcatcggcttcgctcagaaactcgaa
gacgtggtcatcaagaccgtcgagggcggccagatgacgaaggacctcgcaatgctggtc
gggggtgaccagggctacctgaccaccgaggagttcctggccgcactggacatcaacctg
cagaaggccatcgctgagcagtag

DBGET integrated database retrieval system