KEGG   Rhodococcus sp. WMMA185: BFN03_15175Help
Entry
BFN03_15175       CDS       T04814                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhw  Rhodococcus sp. WMMA185
Pathway
rhw00250  Alanine, aspartate and glutamate metabolism
rhw00410  beta-Alanine metabolism
rhw00640  Propanoate metabolism
rhw00650  Butanoate metabolism
rhw01100  Metabolic pathways
rhw01120  Microbial metabolism in diverse environments
Module
rhw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rhw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BFN03_15175
   00650 Butanoate metabolism
    BFN03_15175
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BFN03_15175
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BFN03_15175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhw01007]
    BFN03_15175
Enzymes [BR:rhw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BFN03_15175
Amino acid related enzymes [BR:rhw01007]
 Aminotransferase (transaminase)
  Class III
   BFN03_15175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOW95052
UniProt: A0A1D8TBM2
LinkDB All DBs
Position
complement(3372664..3373896)
Genome map
AA seq 410 aa AA seqDB search
MSPLLAQATPVTVDHGLGCYLYGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQVGSLI
HGQYTTVMHQPMLELTERLGSVLPADLDSVFFANSGSEAVEASLRLSRQATGRPNVIVFH
GGFHGRTVAAATMTTSGTRFSAGFSPLMGGVHVAPFPDAYRYGWTEEEATAFALKELDYI
FSTLTAPEETAAFVVEPVLGEGGYVPGNTAFFQGLRERADRYGILLVIDEIQTGFGRTGK
FFGHQHFDVRPDIITIAKGLASGFPLSGIAASEELMAKAWPGSQGGTYGGNAVSCAAAIA
TLEVIEKEGLVANAATRGTQLIEGARRTATSAVGDVRGLGLMVGSEFTAADGSPDRAKAA
AAQQLAAKKGLLLLTCGAHMNVVRMIPALVVTAEQVEDALTLWSEVLEEI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ctgtctccactgctcgcgcaggccacacccgtgacggttgatcatggactcggctgctac
ctctacggtaccgatggtcggcgctatctcgatttcaccgcgggtatcggcgtcaccagt
acggggcactgccatccgcacgtcgtggaggccgcccgccggcaggtcggctcgctgatc
cacggccagtacacgacggtcatgcaccagccgatgctcgagctgaccgagcgtctcggc
tcggttctgcccgccgacctcgattccgtgttcttcgcgaactccggtagcgaggcagtg
gaggcgtcgcttcgtctgtcacgacaggcgacggggcgtcccaacgtgatcgtcttccac
ggcggcttccacggacgcacggtcgcggcggcgaccatgaccacatcgggaacccggttc
tcggcaggcttcagcccgttgatgggtggtgtccatgttgcgccgttcccggatgcctac
cgctatggatggacggaggaagaggccaccgcctttgcgctcaaagaactcgactacatc
ttctccactctcaccgcgccggaggagacggccgcgttcgtcgtcgaacccgtcctgggt
gagggaggctatgtgccgggcaacaccgcgttcttccagggactccgcgagcgagccgac
cggtacggcatcctgctcgtcatcgacgagatccagaccggtttcggacgcaccggcaag
ttcttcggacaccaacacttcgatgtccggcccgacatcatcacgatcgccaaggggctg
gccagtgggttcccgctgtcgggcattgcggcgtccgaggagttgatggccaaggcctgg
ccgggttcgcagggcggaacgtacgggggaaacgcggtgtcctgcgcggccgcgatcgcg
acgctcgaagtgatcgagaaggaaggcctcgtggccaacgcggccactcgcggcacgcaa
cttatcgagggtgctcgccgcacggctacctcggcggtgggggatgtgcgcggtctcgga
ctgatggtgggcagtgagttcaccgctgccgacggttccccggatcgagcgaaagcggct
gccgcgcagcaattggccgcgaagaaggggctactgctgctgacctgcggcgctcacatg
aacgtggtgcgaatgattccggcgctcgtcgtgacggcagaacaggtggaggatgcgctg
acactctggtcggaagtcctcgaggagatctga

DBGET integrated database retrieval system