KEGG   Rhizobium sp. N731: AMK02_CH00110Help
Entry
AMK02_CH00110     CDS       T04809                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00061  Fatty acid biosynthesis
rhx00780  Biotin metabolism
rhx01100  Metabolic pathways
rhx01212  Fatty acid metabolism
Module
rhx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AMK02_CH00110 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AMK02_CH00110 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhx01004]
    AMK02_CH00110 (fabB)
Enzymes [BR:rhx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     AMK02_CH00110 (fabB)
Lipid biosynthesis proteins [BR:rhx01004]
 Fatty acid synthase
  Component type
   AMK02_CH00110 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc CbbQ_C
Motif
Other DBs
NCBI-ProteinID: ANK83769
LinkDB All DBs
Position
118153..119385
Genome map
AA seq 410 aa AA seqDB search
MRRVVVTGLGIVSSIGSDAAEVTESLRQAKSGISFSNDFAEHGFKCQVWGSPKLGQTELG
ELVDRRAMRFLSQGGAWNHVAMKQAIADSGLEEKDYAQNERAGIIMGSGGPSTRTLIEAA
EITVKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMI
QWGKQDMMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDTASRAYDVNRDGFVIAGGAGV
LVLEELERAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALSTVKGDVDYINT
HGTSTPVGDSKEIGAIREVFGTKIPHIQSTKSLTGHSLGAAGVQESIYSLLMMQQGFIGE
SAHIAELDPEFEGVPIVRKRIDNAKIDIALSNSFGFGGTNATLVFQRHNG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagacgggtagttgtcacgggtctgggtatcgtttcctcgatcggaagcgatgcggcc
gaagtcaccgaatccttgcgccaggcaaagtcgggtatctccttttccaacgatttcgcc
gaacacggcttcaagtgccaggtctggggcagccccaagctcggccagacggagcttggg
gaactggtcgatcgccgcgccatgcgcttcctgtcgcagggcggcgcctggaaccatgtc
gccatgaagcaggcgatcgccgattccggtctggaagagaaggactacgcccagaacgaa
cgcgccggcatcatcatgggatccggcggaccgtcaacccgcacgctcatcgaggcggcc
gagatcaccgtcaagaacaatagcccgaagcgcattggtcccttcgccgtgccgaaggcg
atgtcctccaccgcgtcggccacactcgccacctggttcaagatccacggcgtcaattat
tcgatctcgtcggcctgctcgacctctgcccattgcatcggcaacgccgctgaaatgatc
cagtggggcaagcaggacatgatgtttgccggcggccacgaagatctcgactggacgatg
tccaatctcttcgacgccatgggcgccatgtcctccaagtacaacgacacgcccgatacc
gcctcgcgcgcctatgacgtcaaccgcgacggcttcgtcatcgccggcggcgccggcgtg
ctggtgctggaggagctggagcgcgccaaggctcgcggcgccaaaatctacgccgaaatc
gtcggctacggcgccacctctgatggttacgacatggtcgctccctcgggcgagggcgct
atccgctgcatgcgccaggcgctttccaccgtcaaaggcgatgtcgactatatcaacact
cacggcacgtcgacgccggtcggcgacagcaaggaaatcggcgccatccgcgaggtgttc
ggcaccaagatcccgcatatccagtcgaccaagtcgctgaccggccattcgctcggtgca
gccggcgtgcaggaatcgatctattccctgctgatgatgcagcaaggtttcatcggcgaa
agcgcccatatcgccgagctcgatcccgaattcgaaggcgtgccgatcgtgcgcaagcga
atcgacaatgcgaagatcgatatcgctctctccaattccttcggcttcggcgggacgaac
gccacgctcgtcttccagcgccataacggataa

DBGET integrated database retrieval system