KEGG   Rhizobium sp. N731: AMK02_CH00111Help
Entry
AMK02_CH00111     CDS       T04809                                 

Gene name
fabI-1
Definition
(GenBank) enoyl-(acyl carrier protein) reductase 1
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00061  Fatty acid biosynthesis
rhx00780  Biotin metabolism
rhx01100  Metabolic pathways
rhx01130  Biosynthesis of antibiotics
rhx01212  Fatty acid metabolism
Module
rhx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AMK02_CH00111 (fabI-1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AMK02_CH00111 (fabI-1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AMK02_CH00111 (fabI-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rhx01004]
    AMK02_CH00111 (fabI-1)
Enzymes [BR:rhx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AMK02_CH00111 (fabI-1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AMK02_CH00111 (fabI-1)
Lipid biosynthesis proteins [BR:rhx01004]
 Fatty acid synthase
  Component type
   AMK02_CH00111 (fabI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF2463
Motif
Other DBs
NCBI-ProteinID: ANK83770
LinkDB All DBs
Position
119390..120196
Genome map
AA seq 268 aa AA seqDB search
MTGIMQGKRGLVMGVANNHSIAWGISKALAAQGADLAFTYQGDALGKRVKPLAAEVGSDF
VLPCDVEDIASVDAVVDSLGERWGKLDFIVHAIGFSDKNELKGLYADTTRENFSRTMVIS
CFSFTEIAKRCAPLMEGSGAMLTLTYNGSTRVIPNYNVMGVAKAALEASVRYLAADYGPR
GIRVNGISAGPIRTLAGAGISDARAILSWNQRNAPLRKTVTIDQVGSSALYLLSDLSAGV
TGEIHFVDAGFNITSMPTLDTLRNADVE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactggaatcatgcagggtaagcgcggcctcgttatgggcgtcgccaacaaccactcg
atcgcctggggaatttcgaaggccctcgccgcacagggtgcggacctcgccttcacctat
cagggcgatgcgctcggcaagcgcgtcaagccgcttgccgccgaagtcggctcggatttc
gtgctcccctgcgacgtcgaggacatcgcctcggtcgacgctgtagtcgactcgctcggc
gagcgctggggcaagctcgattttatcgtccatgccatcggcttctccgacaagaacgag
ctgaagggcctctacgccgatacgacgcgggagaatttcagccgcaccatggtcatctcc
tgcttctccttcaccgagatcgccaagcgctgcgcaccgctgatggaaggcagtggcgcg
atgctgacactgacctataacggctcgacgcgcgtcattccgaattacaatgtcatgggt
gtcgccaaggcggcgctcgaggcttcggtgcgttatctcgccgccgattacggcccgcgc
ggcatccgcgtcaacggcatttccgccggcccgatccgcacgcttgccggcgccggcatt
tcggacgcgcgcgcaatcctctcctggaaccagcgcaatgcgccattgcgcaagaccgtg
accatcgatcaggtcggcagttcggcgctctatctgctctccgacctctccgccggcgtc
accggcgaaatccatttcgtcgatgccggcttcaacatcacctcgatgccgacgctggac
accctgcgcaacgcagacgtggaataa

DBGET integrated database retrieval system