KEGG   Rhizobium sp. N731: AMK02_CH00593Help
Entry
AMK02_CH00593     CDS       T04809                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00071  Fatty acid degradation
rhx00280  Valine, leucine and isoleucine degradation
rhx00281  Geraniol degradation
rhx00310  Lysine degradation
rhx00362  Benzoate degradation
rhx00380  Tryptophan metabolism
rhx00410  beta-Alanine metabolism
rhx00640  Propanoate metabolism
rhx00650  Butanoate metabolism
rhx00903  Limonene and pinene degradation
rhx00930  Caprolactam degradation
rhx01100  Metabolic pathways
rhx01110  Biosynthesis of secondary metabolites
rhx01120  Microbial metabolism in diverse environments
rhx01130  Biosynthesis of antibiotics
rhx01200  Carbon metabolism
rhx01212  Fatty acid metabolism
Module
rhx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AMK02_CH00593 (fadJ)
   00650 Butanoate metabolism
    AMK02_CH00593 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMK02_CH00593 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMK02_CH00593 (fadJ)
   00310 Lysine degradation
    AMK02_CH00593 (fadJ)
   00380 Tryptophan metabolism
    AMK02_CH00593 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMK02_CH00593 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMK02_CH00593 (fadJ)
   00281 Geraniol degradation
    AMK02_CH00593 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMK02_CH00593 (fadJ)
   00930 Caprolactam degradation
    AMK02_CH00593 (fadJ)
Enzymes [BR:rhx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AMK02_CH00593 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMK02_CH00593 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AMK02_CH00593 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 NAD_binding_7 NAD_binding_8 UDPG_MGDP_dh_N 2-Hacid_dh_C ApbA Pyr_redox Pyr_redox_2 FAD_binding_3 GIDA
Motif
Other DBs
NCBI-ProteinID: ANK84235
LinkDB All DBs
Position
594533..596749
Genome map
AA seq 738 aa AA seqDB search
MSSYTNFTIETDADGIALVTWDMPGKSMNVFTAEVMEELNAIIDATTADAAVKGVVFTSG
KSSFSGGADLSMIKSMFSSYQEEKARSPEKAVQTLFGLVGRMSGLFRKLETSGKPWVSAI
NGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLANAQDALQMM
TTGQSLSGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAPWDEKGFKLPGGGIWTPA
SAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGLKIEQRYFTEVLQTREAFS
MIRSLFISMQELGKGARRPAGIAKTELKHVGVVGAGFMGASIAYVTAAAGLPVTLIDRDM
EAAAKGKAVSEGLVKDSIGKGRLTQDEAAALLSRITPSADYADLANADLVIEAVFEDRGV
KKAVIEAVEAVLPEGAIFASNTSTLPITGLAKNSRRPADFIGIHFFSPVEKMMLTEVILG
KETGDKALAVALDYVAAIKKTPIVVNDTRGFFVNRCVLRYMSESYDMLIEGVPPAMIENA
AKMAGMPVGPLALNDEVAIDLSLRILKATVADLGEKAIDPRHMELISRMVEKEGRFGRKN
SKGFYDYPPKPAKKSLWPELKDFYPQKKADEVDVAVLKQRFLVAIALEAARTVEEGIVTD
PREADVGSILGFGFAPYTGGALSYIDGMGAKAFVELAEKLAGAYGDHFKPTPLLKDMAAR
GETFYGRFDPYAKMGAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctacaccaatttcacgatcgaaaccgacgccgacggcatcgcgctcgtcacc
tgggacatgcccggcaaatcgatgaacgtcttcaccgccgaggtgatggaagagctcaac
gccatcatcgacgcgaccactgccgacgccgccgtcaagggtgtcgtcttcacatcaggc
aaatcctccttctccggcggcgccgatctgtcgatgatcaagtcgatgttcagctcctat
caagaggagaaggccaggagcccggagaaggcggtgcagacgctcttcggtctcgtcggc
cggatgagcggcctgttccgtaagctcgaaacctcgggcaagccctgggtgtcggcgatc
aacggcacctgcatgggcggcgcctttgaactgtcgcttgcctgccatggccgcgtcgct
tcgaatgccaagagcgtcaagatcgcgctgcccgaggtcaaggtcggtatcttccccggc
gccggcggcacccagcgcgtgccgcggctggcgaacgcccaggacgcgctgcagatgatg
acgacgggtcagtcgctgagcggctcgcgcgccaaggcgatgaacctcgtgcatcaggtg
gtcgagccggatcaactgatccccgccgccaagcagatgatcaaggatggcctgaagccg
gttgccccctgggacgagaagggcttcaagctgccgggcggcggcatctggacgccggcc
tccgcccagctctggccggccgcgccggcgatcctgcgccgggaaacatcgggcaattat
ccggcagcactcgctatcctgaaatgcgtctatgaaggcctgcaggtgccattcgatacc
gggctgaagatcgagcagcgttatttcaccgaggtgctgcagacccgcgaagccttctcg
atgatccgctcgctgttcatctccatgcaggagcttggcaagggcgcccgtcgccctgcc
ggcattgccaagaccgagctcaagcatgtcggcgtcgtcggcgccggcttcatgggcgcc
tcgattgcctatgtcacggctgctgccggtctcccggtgacgctgatcgaccgcgacatg
gaggccgccgctaagggcaaggccgtctccgaaggcctcgtcaaggattctatcggtaag
ggacggctgacgcaggacgaggcggcagccctcctctcccgcatcacgccttcggccgat
tatgccgatctcgccaatgccgatctcgtcatcgaggcggtgttcgaagatcgcggtgtg
aagaaagcggtcatcgaggcggttgaagccgtgctgcccgaaggggcgatcttcgcctcc
aatacctcgaccctgccgatcacgggtcttgcgaagaattccagacgcccggccgatttt
atcggcatccacttcttctcgcccgtggagaagatgatgctgaccgaggtcatcctcggc
aaggagaccggcgacaaggcgctggccgtcgcgcttgattacgtcgccgcgatcaagaag
acgccgatcgtcgtcaacgacacccgcggtttcttcgtcaatcgctgcgtgctgcgctac
atgtcggaaagctacgacatgctgatcgaaggcgtgccgcctgccatgatcgagaatgct
gccaagatggccggcatgccggtcggtccgctggcgctcaacgacgaggtcgccatcgac
ctgtcgctgaggatcctcaaggcgaccgttgccgatctcggcgagaaggctatcgacccc
aggcacatggagttgatctcccgcatggtggagaaggagggccgcttcggccgcaagaat
tccaaaggcttctacgactatccgccgaaaccggcgaagaagtcgctctggcccgagctc
aaggacttctatccgcagaagaaggcggatgaggtcgatgtcgcggtgctgaagcagcgc
ttcctcgtcgccatcgcgctcgaagccgcccgcacggtcgaagaaggcatcgtcaccgat
ccgcgcgaagccgacgtcggttcgatcctcggcttcggcttcgcgccctataccggcggg
gcgctgagctatatcgacgggatgggcgcaaaggcttttgtggaactggcggaaaagtta
gcgggagcttacggagatcactttaagccgacaccgctgctgaaggacatggctgccagg
ggtgagacgttttacgggcggttcgatccctatgcgaagatgggggcggcggcgtaa

DBGET integrated database retrieval system