KEGG   Rhizobium sp. N731: AMK02_CH02006Help
Entry
AMK02_CH02006     CDS       T04809                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00010  Glycolysis / Gluconeogenesis
rhx00020  Citrate cycle (TCA cycle)
rhx00620  Pyruvate metabolism
rhx01100  Metabolic pathways
rhx01110  Biosynthesis of secondary metabolites
rhx01120  Microbial metabolism in diverse environments
rhx01130  Biosynthesis of antibiotics
rhx01200  Carbon metabolism
Module
rhx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rhx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMK02_CH02006 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AMK02_CH02006 (pdhC)
   00620 Pyruvate metabolism
    AMK02_CH02006 (pdhC)
Enzymes [BR:rhx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMK02_CH02006 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N HlyD_2 DUF2118
Motif
Other DBs
NCBI-ProteinID: ANK85591
LinkDB All DBs
Position
1987863..1989209
Genome map
AA seq 448 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VPAGTEGVKVNALIAVLAADGEDVSAAASAAGSAAPAKAEAAPAPKADAAPAKAEAAPAA
APAPAAPAAVSAGGNRTFSSPLARRLAREAGIDLSNVAGSGPHGRVIKSDIEAALAGGAK
PAPAPAAALASQAAAPAPAAAKGGSEDAVLKLFEPGSYELVPHDGMRKTIARRLVESKQT
IPHFYVSVDCELDALMALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALALRDVPDANVS
WTDNNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSVISNEMRDLGKRAKDRKLKPEE
YQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLSTD
HRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctttcc
aagtggctggtcaaggaaggcgataaggtcaagtctggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgacgaaggcacggtcgccaagctcgtc
gttcctgccggcaccgaaggtgtcaaggtcaatgcgctgatcgccgttctcgccgccgat
ggcgaagatgtttccgctgctgcgagcgccgcaggttccgccgctccggccaaggcagag
gccgcacctgcgccgaaggccgacgctgcgccggcgaaggctgaggccgctccggccgcg
gcaccggcgcctgccgcgcccgcggccgtttcggctggtggcaaccgcaccttctcttcg
ccgctcgcacgccgcctggccagggaagccggtatcgacctctctaatgtcgccggttcc
ggtccgcatggccgcgtgatcaagagcgatatcgaagctgctcttgccggcggcgccaag
cccgctccggcgcctgccgctgctttggcttcacaggctgccgcgccggctccggccgcc
gcgaagggtggctccgaggacgccgtgctcaagctcttcgagccgggctcctacgagctt
gtgccgcatgacggcatgcgcaagacgatcgcccggcggctggtcgaatccaagcagacg
atcccgcatttctacgtcagcgtcgattgcgagctcgatgctctgatggcgctccgcgcc
cagctgaatgatgcggctccgcgcaaggacaacgctccggcctacaagctctcggtcaac
gacatggtcatcaaggccatggcgctggcgctgcgcgatgttccggacgccaatgtgtcg
tggaccgacaacaacatggtcaagcacaagcacgccgacgtcggcgtcgctgtctcgatc
cccggcggcctgatcacgccgatcatccgcaaggccgagcagaagacgctgtctgtcatc
tccaacgagatgcgcgatctcggcaagcgggccaaggaccgcaagctgaagcccgaggaa
tatcagggcggcaccagttcggtttcgaacatgggtatgatgggcgtcaagaacttcgcc
gccgtcgtcaatccgccgcatgcgacgatcctggccgtcggcgccggcgagcagcgggtc
gtggtcaagaacggcgagatggccatcgccacggtgatgtcggtgacgctgtcgaccgac
catcgctgcgtcgacggcgccctcggcgccgagctgctccaggccttcaagggctacatc
gaaaacccgatgggcatgcttgtctga

DBGET integrated database retrieval system